Skip to Content
Merck
CN

AV09001

Sigma-Aldrich

Anti-DOK1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Docking protein 1, 62 kDa (downstream of tyrosine kinase 1), Anti-MGC117395, Anti-MGC138860, Anti-P62DOK

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

53 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... DOK1(1796)

Immunogen

Synthetic peptide directed towards the C terminal region of human DOK1

Application

Anti-DOK1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25 μg/ml.

Biochem/physiol Actions

DOK1 is a tumor suppressor protein that is repressed by hypermethylation in a variety of human tumors. DOK1 transcription is regulated by E2F1 transcription factor and is important during cellular stress and etoposide-induced DNA damage. DOK1 is the critical mediator of stress-induced cell death. Inactivation of DOK1 is a frequent feature in head and neck cancers.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: EPGTATGSGIKSHNSALYSQVQKSGASGSWDCGLSRVGTDKTGVKSEGST

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Amandine Saulnier et al.
International journal of cancer, 130(11), 2484-2494 (2011-07-29)
The DOK1 gene is a putative tumour suppressor gene located on the human chromosome 2p13 which is frequently rearranged in leukaemia and other human tumours. We previously reported that the DOK1 gene can be mutated and its expression down-regulated in
Maha Siouda et al.
Molecular and cellular biology, 32(23), 4877-4890 (2012-10-03)
The expression of the tumor suppressor DOK1 is repressed in a variety of human tumors as a result of hypermethylation of its promoter region. However, the molecular mechanisms by which DOK1 expression is regulated have been poorly investigated. Here, we

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service