AV09001
Anti-DOK1 antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-Docking protein 1, 62 kDa (downstream of tyrosine kinase 1), Anti-MGC117395, Anti-MGC138860, Anti-P62DOK
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
53 kDa
species reactivity
human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... DOK1(1796)
Immunogen
Synthetic peptide directed towards the C terminal region of human DOK1
Application
Anti-DOK1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25 μg/ml.
Biochem/physiol Actions
DOK1 is a tumor suppressor protein that is repressed by hypermethylation in a variety of human tumors. DOK1 transcription is regulated by E2F1 transcription factor and is important during cellular stress and etoposide-induced DNA damage. DOK1 is the critical mediator of stress-induced cell death. Inactivation of DOK1 is a frequent feature in head and neck cancers.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: EPGTATGSGIKSHNSALYSQVQKSGASGSWDCGLSRVGTDKTGVKSEGST
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Amandine Saulnier et al.
International journal of cancer, 130(11), 2484-2494 (2011-07-29)
The DOK1 gene is a putative tumour suppressor gene located on the human chromosome 2p13 which is frequently rearranged in leukaemia and other human tumours. We previously reported that the DOK1 gene can be mutated and its expression down-regulated in
Maha Siouda et al.
Molecular and cellular biology, 32(23), 4877-4890 (2012-10-03)
The expression of the tumor suppressor DOK1 is repressed in a variety of human tumors as a result of hypermethylation of its promoter region. However, the molecular mechanisms by which DOK1 expression is regulated have been poorly investigated. Here, we
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service