AV15002
Anti-KRT14 antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-Keratin 14 (epidermolysis bullosa simplex, Dowling-Meara, Koebner)
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
52 kDa
species reactivity
human, rat
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... KRT14(3861)
Related Categories
Immunogen
Synthetic peptide directed towards the C terminal region of human KRT14
Application
Anti-KRT14 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 μg/ml.
Biochem/physiol Actions
Keratins are abundantly present structural proteins in epithelial cells. Keratins 5 and 14 are primary structural proteins of stratifying epithelia. Mutations in K14 gene or defects in K5-K14 network results in Epidermolysis bullosa simplex, a condition characterized by superficial bullous lesions on skin epithelia.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: DAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Pierre A Coulombe et al.
The Journal of clinical investigation, 119(7), 1784-1793 (2009-07-10)
Epidermolysis bullosa (EB) simplex is a rare genetic condition typified by superficial bullous lesions that result from frictional trauma to the skin. Most cases are due to dominantly acting mutations in either keratin 14 (K14) or K5, the type I
E L Rugg et al.
Genes & development, 8(21), 2563-2573 (1994-11-01)
The importance of keratins and other intermediate filaments in the maintenance of tissue structure is emphasized by the discovery that many hereditary skin-blistering diseases are caused by mutations in keratin genes. Here, we describe a situation in which keratin 14
Pierre A Coulombe et al.
The Journal of investigative dermatology, 132(3 Pt 2), 763-775 (2012-01-27)
Epidermolysis bullosa simplex (EBS) is a rare genetic condition typified by superficial bullous lesions following incident frictional trauma to the skin. Most cases of EBS are due to dominantly acting mutations in keratin 14 (K14) or K5, the type I
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service