Skip to Content
Merck
CN

AV30313

Anti-PDPK1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-3-Phosphoinositide dependent protein kinase-1, Anti-MGC20087, Anti-MGC35290, Anti-PDK1, Anti-PRO0461, Anti-PkB-like, Anti-PkB-like1

Sign In to View Organizational & Contract Pricing

Select a Size

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

Key Documents

View All Documentation
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

63 kDa

species reactivity

bovine, horse, dog, rabbit, human, mouse, guinea pig, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

XP_001715356

UniProt accession no.

O15530

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PDPK1(5170)

Related Categories

General description

PDPK1 is a kinase that regulates several signaling pathways mediated by various hormones and growth factors. PDPK1 has been implicated in breast cancer metastasis and prostate cancer progression.
Rabbit Anti-PDPK1 antibody recognizes human, mouse, rat, zebrafish, and pig PDPK1.

Immunogen

Synthetic peptide directed towards the middle region of human PDPK1

Application

Rabbit Anti-PDPK1 antibody has been used for western blot assays at a concentration of 0.5μg/ml.

Biochem/physiol Actions

PDPK1 phosphorylates and activates not only PKB/AKT, but also PKA, PKC-zeta, RPS6KA1 and RPS6KB1. It may play a general role in signaling processes and in development.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: IIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVS

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number
QC12022

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Khalil A Choucair et al.
Translational oncology, 5(6), 453-460 (2013-02-13)
Prostate cancer (PCa) is a leading cause of cancer death, and distinguishing aggressive from indolent tumors is a major challenge. Identification and characterization of genomic alterations associated with advanced disease can provide new markers of progression and better therapeutic approaches.
Chanse Fyffe et al.
Cancer management and research, 5, 271-280 (2013-09-17)
It should be noted that 3-phosphoinositide-dependent protein kinase-1 (PDK1) is a protein encoded by the PDPK1 gene, which plays a key role in the signaling pathways activated by several growth factors and hormones. PDK1 is a crucial kinase that functions
Aaron Pitre et al.
Molecular biology of the cell, 23(7), 1243-1253 (2012-02-18)
The intermediate filament protein synemin is present in astrocyte progenitors and glioblastoma cells but not in mature astrocytes. Here we demonstrate a role for synemin in enhancing glioblastoma cell proliferation and clonogenic survival, as synemin RNA interference decreased both behaviors

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service