Skip to Content
Merck
CN

AV31918

Sigma-Aldrich

Anti-TFCP2L1 (AB1) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Transcription factor CP2-like 1

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

54 kDa

species reactivity

human, bovine, dog, rabbit

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TFCP2L1(29842)

Related Categories

General description

Tfcp2l1 is a transcription factor that belongs to the CP2 family of proteins. This transcription factor has been implicated in the self-renewal pathways of embryonic stem (ES) cells. TFCP2L1 may also be involved in the differentiation of epithelial cells.
Rabbit Anti-TFCP2L1 recognizes bovine, chicken, human, mouse, and rat TFCP2L1.

Immunogen

Synthetic peptide directed towards the N terminal region of human TFCP2L1

Application

Rabbit Anti-TFCP2L1 can be used for western blot (2μg/ml) and IHC (4-8μg/ml, using paraffin embedded tissues) applications.

Biochem/physiol Actions

TFCP2L1 is a candidate CP2 family member. It is expressed in a developmentally regulated fashion in vivo and acts as a direct repressor of transcription. CP2-related proteins comprise a family of DNA-binding transcription factors that are generally activators of transcription and expressed ubiquitously.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: LRDVLALPIFKQEEPQLSPENEARLPPLQYVLCAATSPAVKLHEETLTYL

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Han W Tun et al.
PloS one, 5(5), e10696-e10696 (2010-05-27)
Clear cell renal cell carcinoma (ccRCC) is the most common kidney cancer. The purpose of this study is to define a biological pathway signature and a cellular differentiation program in ccRCC. We performed gene expression profiling of early-stage ccRCC and
Shoudong Ye et al.
The EMBO journal, 32(19), 2548-2560 (2013-08-15)
Mouse embryonic stem cell (mESC) self-renewal can be maintained by activation of the leukaemia inhibitory factor (LIF)/signal transducer and activator of transcription 3 (Stat3) signalling pathway or dual inhibition (2i) of glycogen synthase kinase 3 (Gsk3) and mitogen-activated protein kinase

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service