AV31918
Anti-TFCP2L1 (AB1) antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-Transcription factor CP2-like 1
Sign In to View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
54 kDa
species reactivity
human, bovine, dog, rabbit
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... TFCP2L1(29842)
Related Categories
General description
Tfcp2l1 is a transcription factor that belongs to the CP2 family of proteins. This transcription factor has been implicated in the self-renewal pathways of embryonic stem (ES) cells. TFCP2L1 may also be involved in the differentiation of epithelial cells.
Rabbit Anti-TFCP2L1 recognizes bovine, chicken, human, mouse, and rat TFCP2L1.
Rabbit Anti-TFCP2L1 recognizes bovine, chicken, human, mouse, and rat TFCP2L1.
Immunogen
Synthetic peptide directed towards the N terminal region of human TFCP2L1
Application
Rabbit Anti-TFCP2L1 can be used for western blot (2μg/ml) and IHC (4-8μg/ml, using paraffin embedded tissues) applications.
Biochem/physiol Actions
TFCP2L1 is a candidate CP2 family member. It is expressed in a developmentally regulated fashion in vivo and acts as a direct repressor of transcription. CP2-related proteins comprise a family of DNA-binding transcription factors that are generally activators of transcription and expressed ubiquitously.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: LRDVLALPIFKQEEPQLSPENEARLPPLQYVLCAATSPAVKLHEETLTYL
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Han W Tun et al.
PloS one, 5(5), e10696-e10696 (2010-05-27)
Clear cell renal cell carcinoma (ccRCC) is the most common kidney cancer. The purpose of this study is to define a biological pathway signature and a cellular differentiation program in ccRCC. We performed gene expression profiling of early-stage ccRCC and
Shoudong Ye et al.
The EMBO journal, 32(19), 2548-2560 (2013-08-15)
Mouse embryonic stem cell (mESC) self-renewal can be maintained by activation of the leukaemia inhibitory factor (LIF)/signal transducer and activator of transcription 3 (Stat3) signalling pathway or dual inhibition (2i) of glycogen synthase kinase 3 (Gsk3) and mitogen-activated protein kinase
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service