AV31966
Anti-HOXD11 antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-HOX4, Anti-HOX4F, Anti-Homeobox D11
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
35 kDa
species reactivity
human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... HOXD11(3237)
General description
HOXD11 is a homeobox transcription factor that regulates morphogenesis. It is known to modulate metanephric kidney development in mouse embryos. Hoxd11 mutations have been linked to axial skeleton homeostasis and forelimb malformations.
Rabbit Anti-HOXD11 antibody recognizes human, bovine, mouse, and canine HOXD11.
Rabbit Anti-HOXD11 antibody recognizes human, bovine, mouse, and canine HOXD11.
Immunogen
Synthetic peptide directed towards the middle region of human HOXD11
Application
Rabbit Anti-HOXD11 antibody can be used for western blot applications at a concentration of 0.25μg/ml.
Biochem/physiol Actions
HOXD11 belongs to the homeobox family. This family play an important role in morphogenesis in all multicellular organisms. The mouse Hoxd11 plays a role in forelimb morphogenesis.This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5′ end of this cluster have been associated with severe limb and genital abnormalities. The product of the mouse Hoxd11 gene plays a role in forelimb morphogenesis.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: GFDQFYEAAPGPPFAGPQPPPPPAPPQPEGAADKGDPRTGAGGGGGSPCT
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
B Favier et al.
Proceedings of the National Academy of Sciences of the United States of America, 92(1), 310-314 (1995-01-03)
The Hoxd-11 gene was disrupted by homologous recombination in embryonic stem cells. We found that Hoxd-11-/- mutant mice are viable and display homeotic transformations of their sacral vertebrae, while their forelimbs present abnormalities of some metacarpals and of the first
Joshua W Mugford et al.
Developmental biology, 319(2), 396-405 (2008-05-20)
The mammalian kidney consists of an array of tubules connected to a ductal system that collectively function to control water/salt balance and to remove waste from the organisms' circulatory system. During mammalian embryogenesis, three kidney structures form within the intermediate
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service