Skip to Content
Merck
CN

AV46095

Sigma-Aldrich

Anti-ATIC (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-5-Aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase, Anti-AICAR, Anti-AICARFT, Anti-IMPCHASE, Anti-PURH

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

64 kDa

species reactivity

yeast, guinea pig, mouse, human, rabbit, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ATIC(471)

Related Categories

Immunogen

Synthetic peptide directed towards the N terminal region of human ATIC

Application

Anti-ATIC (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.

Biochem/physiol Actions

ATIC gene encodes a bifunctional enzyme 5-Amino-4-imidazolecarboxamide ribonucleotide transformylase/IMP cyclohydrolase. The enzyme is responsible for catalysis of the last two steps in the de novo synthesis of inosine 5′-monophosphate. The N-terminal domain comprise of phosphoribosylaminoimidazolecarboxamide formyltransferase activity whereas the C-terminal domain has IMP cyclohydrolase activity. Mutation in ATIC gene results in destabilization of various degrees of purinosome assembly which leads to AICA-ribosiduria.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: YVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKG

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Karen G Bulock et al.
The Journal of biological chemistry, 277(25), 22168-22174 (2002-04-12)
5-Amino-4-imidazolecarboxamide ribonucleotide transformylase/IMP cyclohydrolase (ATIC) is a bifunctional protein possessing two enzymatic activities that sequentially catalyze the last two steps in the pathway for de novo synthesis of inosine 5'-monophosphate. This bifunctional enzyme is of particular interest because of its
Veronika Baresova et al.
Human molecular genetics, 21(7), 1534-1543 (2011-12-20)
The purinosome is a multienzyme complex composed by the enzymes active in de novo purine synthesis (DNPS) that cells transiently assemble in their cytosol upon depletion or increased demand of purines. The process of purinosome formation has thus far been

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service