Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
NACRES:
NA.41
UNSPSC Code:
12352203
Product Name
Anti-PPIF antibody produced in rabbit, IgG fraction of antiserum
Quality Level
biological source
rabbit
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
19 kDa
species reactivity
bovine, rat, dog, horse, rabbit, human, guinea pig, mouse
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... PPIF(10105)
Application
Anti-PPIF antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/ml.
Biochem/physiol Actions
PPIF (peptidylprolyl isomerase F) also referred to as CypD or cyclophilin F belongs to peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases are highly-conserved cytoplasmic enzymes that accelerate protein folding. PPIF is a part of the mitochondrial permeability transition pore (mPTP) in the inner mitochondrial membrane. Hence, it is anticipated that its association with the mPTP masks the binding site for inhibiting inorganic phosphate (Pi) as well as enhances the open possibility of mPTP that results in apoptosis or necrosis.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the middle region of human PPIF
Other Notes
Synthetic peptide located within the following region: GSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLS
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Angelina V Vaseva et al.
Cell, 149(7), 1536-1548 (2012-06-26)
Ischemia-associated oxidative damage leading to necrosis is a major cause of catastrophic tissue loss, and elucidating its signaling mechanism is therefore of paramount importance. p53 is a central stress sensor responding to multiple insults, including oxidative stress to orchestrate apoptotic
Roman A Eliseev et al.
The Journal of biological chemistry, 284(15), 9692-9699 (2009-02-21)
Cyclophilin D (CypD) is a mitochondrial immunophilin and a key positive regulator of the mitochondrial permeability transition (MPT). Several reports have shown that CypD is overexpressed in various tumors, where it has an anti-apoptotic effect. Because the MPT is a
Yuan He et al.
Investigative ophthalmology & visual science, 49(11), 4912-4922 (2008-07-11)
Disruption in intracellular calcium ion (Ca(2+)) homeostasis has major effects on health. Persistent Ca(2+) overload induces mitochondrial permeability transition pore (MPTP) opening, which prompts mitochondrial release of calcium (mCICR) and reactive oxygen species (ROS) into the cytosol which, in turn
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service