Skip to Content
Merck
CN

AV54268

Sigma-Aldrich

Anti-ATG16L1 (AB1) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-APG16L, Anti-ATG16 autophagy related 16-like 1 (S. cerevisiae), Anti-ATG16L, Anti-FLJ00045, Anti-FLJ10035, Anti-FLJ10828, Anti-FLJ22677, Anti-IBD10

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

66 kDa

species reactivity

rat, mouse, bovine, human, guinea pig

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ATG16L1(55054)

Related Categories

Immunogen

Synthetic peptide directed towards the N terminal region of human ATG16L1

Application

Anti-ATG16L1 (AB1) antibody produced in rabbit is suitable for western blot analysis.

Biochem/physiol Actions

ATG16L1 (autophagy related 16-like 1) is an autophagy-related (ATG) protein. It plays an essential role as a component of the ATG12-ATG5-ATG16L1 complex during autophagy. It functions as a molecular scaffold to form the autophagosome in response to classical and pathogen-related autophagy stimuli. The complex introduces LC3 (ATG8 in yeast) to the autophagosome and connects it to the phosphatidylethanolamine (PE). This conjugation generates a membrane-bound activated form of LC3 named LC3-II.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: QYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQ

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Rhiannon Parkhouse et al.
PloS one, 8(9), e76237-e76237 (2013-10-03)
Autophagy is a fundamental cellular process required for organelle degradation and removal of invasive pathogens. Autophagosome formation involves the recruitment of, and interaction between, multiple proteins produced from autophagy-related (ATG) genes. One of the key complexes in autophagosome formation is
Emilio Boada-Romero et al.
The EMBO journal, 32(4), 566-582 (2013-02-05)
Selective autophagy underlies many of the important physiological roles that autophagy plays in multicellular organisms, but the mechanisms involved in cargo selection are poorly understood. Here we describe a molecular mechanism that can target conventional endosomes for autophagic degradation. We
Joëlle Magné et al.
Arteriosclerosis, thrombosis, and vascular biology, 35(5), 1226-1235 (2015-03-15)
Autophagy has emerged as a cell survival mechanism critical for cellular homeostasis, which may play a protective role in atherosclerosis. ATG16L1, a protein essential for early stages of autophagy, has been implicated in the pathogenesis of Crohn's disease. However, it

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service