AV54415
Anti-C9ORF117 antibody produced in rabbit
affinity isolated antibody
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
60 kDa
species reactivity
guinea pig, bovine, human, horse, rat, dog
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... C9orf117(286207)
General description
C9ORF117 (chromosome 9 open reading frame 117) gene encodes a protein located on to 9q34.11. It is a target gene for hsa-miR-151a-3p and was used to examine the association of human diseases with the predicted target genes. Expression of C9ORF117 gene was used to study the mechanisms of respiratory sensitization.
Immunogen
Synthetic peptide directed towards the N terminal region of human C9orf117
Application
Anti-C9ORF117 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: LAKEMEKDAFEAQLAQVRHEFQETKDQLTTENIILGGKLAALEEFRLQKE
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Alan Lap-Yin Pang et al.
Oncology letters, 7(6), 1819-1825 (2014-06-17)
MicroRNAs (miRNAs) are small non-coding RNAs that regulate the expression of their target genes at the post-transcriptional level. In cancer cells, miRNAs, depending on the biological functions of their target genes, may have a tumor-promoting or -suppressing effect. Treatment of
Sandra Verstraelen et al.
Toxicology, 255(3), 151-159 (2008-12-02)
Respiratory sensitization is a concern for occupational and environmental health in consumer product development. Despite international regulatory requirements there is no established protocol for the identification of chemical respiratory sensitizers. New tests should be based on mechanistic understanding and should
S J Humphray et al.
Nature, 429(6990), 369-374 (2004-05-28)
Chromosome 9 is highly structurally polymorphic. It contains the largest autosomal block of heterochromatin, which is heteromorphic in 6-8% of humans, whereas pericentric inversions occur in more than 1% of the population. The finished euchromatic sequence of chromosome 9 comprises
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service