Skip to Content
Merck
CN

AV54533

Sigma-Aldrich

Anti-PELI3 (AB2) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-MGC35521, Anti-Pellino homolog 3 (Drosophila)

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

48 kDa

species reactivity

horse, pig, human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... PELI3(246330)

Related Categories

Immunogen

Synthetic peptide directed towards the N terminal region of human PELI3

Application

Anti-PELI3 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Biochem/physiol Actions

The gene PELI3 encodes a scaffold protein involved in TLR (Toll-like receptor)/IL-1R (IL-1 receptor) signalling pathways that shape innante immunity via interaction with the complex containing IRAK kinases and TRAF6. This leads to to nuclear factor-κB and mitogen activated protein kinase-dependent gene expression. The pellino protein also induces IRAK-1 polyubiquitination in a RING-dependent manner, which in turn regulates TLR/IL-1R signalling. Pellino3 targets the interferon regulatory factor 7 pathway and facilitates autoregulation of toll-like receptors (TLR3)- and viral-induced expression of type I interferons. It also plays a role in mediating ′Lys-63′-linked polyubiquitination of IRAK1 and can stimulate AP1/JUN and ELK1.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: VLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELIVLG

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Reinout Schauvliege et al.
FEBS letters, 580(19), 4697-4702 (2006-08-04)
Members of the Toll-like receptor (TLR) and IL-1 receptor (IL-1R) family initiate signalling pathways that shape innate immunity. Pellino proteins have recently been implicated as evolutionary conserved scaffold proteins in TLR/IL-1R signalling leading to nuclear factor-kappaB and mitogen activated protein
Marion P Butler et al.
The Journal of biological chemistry, 282(41), 29729-29737 (2007-08-07)
Members of the Pellino family are interleukin-1 receptor-associated kinase (IRAK)-interacting proteins that possess RING-like domains. The presence of these domains led to the suggestion that Pellino proteins are ubiquitin-protein isopeptide ligases (E3). However, no conclusive data currently exist to prove
Jakub Siednienko et al.
Nature immunology, 13(11), 1055-1062 (2012-10-09)
Toll-like receptors (TLRs) sense pathogen-associated molecules and respond by inducing cytokines and type I interferon. Here we show that genetic ablation of the E3 ubiquitin ligase Pellino3 augmented the expression of type I interferon but not of proinflammatory cytokines in

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service