Skip to Content
Merck
CN

HPA035241

Anti-COLEC11 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-CL-K1, Anti-MGC3279

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.43
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
10
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:200- 1:500

immunogen sequence

INDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

Gene Information

human ... COLEC11(78989)

General description

Collectin 11 (COLEC11) is member of C-type lectin family of proteins. The members of this family have collagen-like sequence and a calcium dependent carbohydrate recognition domain. They are predominantly expressed in kidney cells. These proteins also interact with extracellular DNA associated with apoptotic cells and biofilms. Collectin 11 is located on human chromosome 2p25.3 and shows two splice variants, resulting in two protein isoforms.

Immunogen

collectin sub-family member 11 recombinant protein epitope signature tag (PrEST)

Application

Anti-COLEC11 antibody produced in rabbit has been used for the detection of human collectin 11 in the ficolin-3 complex using microtiter plate assay.

Biochem/physiol Actions

Collectin 11 (COLEC11) interacts with the antigenic part of the microbes to confer immune response against infections. Genetic polymorphism at promoter level affects collectin 11 expression. An amino acid variation alters its carbohydrate binding functionality. Collectin 11 is a potential host factor for preventing urinary schistosomiasis. Its allelic variation is more susceptible to the disease as the protein binds less effectively to the sugars. COLEC11 plays a key role in phagocytosis and cytokine production. Its level increases in disseminated intravascular coagulation. Mutation in COLLEC11 results in 3MC syndrome, a genetic disorder which is associated with abnormal facial features as a result of incomplete tissue development in the face and skull.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Other Notes

Corresponding Antigen APREST79013

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

常规特殊物品
低风险生物材料
常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Characterization of the interaction between collectin 11 (CL-11, CL-K1) and nucleic acids
Henriksen ML, et al.
Molecular Immunology, 56(4), 757-767 (2013)
Collectin-11 is an important modulator of retinal pigment epithelial cell phagocytosis and cytokine production
Dong X, et al.
Journal of Innate Immunity, 9(6), 529-545 (2017)
Lectin complement protein Collectin 11 (CL-K1) and susceptibility to urinary schistosomiasis
Antony JS, et al.
PLoS Neglected Tropical Diseases, 9(3), e0003647-e0003647 (2015)
Identification and characterization of a novel human collectin CL-K1
Keshi H, et al.
Microbiology and Immunology, 50(12), 1001-1013 (2006)
Elevated plasma CL-K1 level is associated with a risk of developing disseminated intravascular coagulation (DIC)
Takahashi K, et al.
Journal of thrombosis and thrombolysis, 38(3), 331-338 (2014)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service