Skip to Content
Merck
CN

SAB1401142

Sigma-Aldrich

Anti-FOLR3 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

Synonym(s):

FR-G, FR-gamma, gamma-hFR

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

western blot: 1 μg/mL

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... FOLR3(2352)

General description

Folate receptor 3 (FOLR3) gene encodes a member of the folate receptor (FOLR) family, members of which have a high affinity for folic acid and for several reduced folic acid derivatives, and mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This gene includes two polymorphic variants; the shorter one has two base deletion in the CDS, resulting in a truncated polypeptide, compared to the longer one. Both protein products are constitutively secreted in hematopoietic tissues and are potential serum marker for certain hematopoietic malignancies. The longer protein has a 71% and 79% sequence homology with the FOLR1 and FOLR2 proteins, respectively(provided by RefSeq).
Folate receptor 3 (FOLR3) is a secreted protein, which is expressed mainly in hematopoietic tissues. FOLR3 gene is located on human chromosome 11q13.4. FOLR3 gene is 4.2 kb in size.

Immunogen

FOLR3 (AAI48786.1, 1 a.a. ~ 245 a.a) full-length human protein.

Sequence
MDMAWQMMQLLLLALVTAAGSAQPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQVNQSWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSRGIIDS

Biochem/physiol Actions

Folate receptor 3 (FOLR3) is a potential marker for hematopoietic malignancies. FOLR3 may regulate stem cell senescence. FOLR3 binds to folate with high affinity to mediate cellular uptake of folate.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Association of folate receptor (FOLR1, FOLR2, FOLR3) and reduced folate carrier (SLC19A1) genes with meningomyelocele
O'Byrne M, et al.
Birth Defects Research. Part B, Developmental and Reproductive Toxicology, 88(8) (2010)
Structure and regulation of a polymorphic gene encoding folate receptor type γ/γ?
Wang H, et al.
Nucleic Acids Research, 26(9) (1998)
Time-course transcriptional profiling of human amniotic fluid-derived stem cells using microarray
Kim Y, et al.
Cancer Research and Treatment : Official Journal of Korean Cancer Association, 42(2), 82-82 (2010)
Effects of chromosomal variations on pharmacokinetic activity of zolpidem in healthy volunteers: An array-based comparative genomic hybridization study
Moon H, et al.
Biochemical and Biophysical Research Communications, 356(4) (2007)
Novel functions of folate receptor alpha in CNS development and diseases
Mayanil C, et al.
Neuroscience Discovery, 2(1), 5-5 (2014)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service