SAB1410841
Anti-ATP1B3 antibody produced in rabbit
purified immunoglobulin, buffered aqueous solution
Synonym(s):
ATPB-3, CD298, FLJ29027
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
antigen 31.5 kDa
species reactivity
human, rat
technique(s)
western blot: 1 μg/mL
NCBI accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... ATP1B3(483)
General description
ATPase Na+/K+ transporting subunit Β 3 (ATP1B3) is a 43kDa protein, encoded by the gene mapped to human chromosome 3q23. The encoded protein is a member of subfamily of Na+/K+ -ATPases.
Immunogen
ATP1B3 (NP_001670.1, 1 a.a. ~ 279 a.a) full-length human protein.
Sequence
MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA
Sequence
MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA
Biochem/physiol Actions
ATPase Na+/K+ transporting subunit Β 3 (ATP1B3) suppress enterovirus 71 (EV71) replication by elevating the production of type-I interferons, which might act as a potential target in treatment of EV71 infection. The encoded protein is also involved in the regulation of the immune response. Experimental study suggest that ATP1B3 can control restriction of HIV-1 production and nuclear factor Κ B (NF-ΚB) activation in a bone marrow stromal cell antigen 2 (BST-2) dependent manner. Elevated expression of ATP1B3 has been observed in colon and lung cancer.
Physical form
Solution in phosphate buffered saline, pH 7.4
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
ATP1B3: a virus-induced host factor against EV71 replication by up-regulating the production of type-I interferons.
Lu Y
Virology, 496, 28-34 (2016)
Genetic markers associated with early cancer-specific mortality following prostatectomy.
Liu W
Cancer, 119, 2405-2412 (2013)
Identification and characterization of angiogenesis targets through proteomic profiling of endothelial cells in human cancer tissues.
Mesri M
PLoS ONE, 8 (2013)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service