SAB2104963
Anti-FAM135B antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-C8ORFK32, Anti-MGC126009, Anti-MGC126010, Anti-MGC33221
Sign In to View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
156 kDa
species reactivity
human, guinea pig, bovine, mouse, horse, dog, rabbit, rat
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... FAM135B(51059)
Related Categories
General description
FAM135B (family with sequence similarity 135 member B) gene is localized to human chromosome 8. This gene shows wide level of tissue expression, including heart and brain.
Immunogen
Synthetic peptide directed towards the middle region of human FAM135B
Biochem/physiol Actions
FAM135B (family with sequence similarity 135 member B) is a new oncogene that facilitates malignancy in SCC (squamous cell carcinoma) cells and ESCC (esophageal SCC). This gene participates in cell activity and signaling, including in brain. Polymorphism in this gene is linked with extrapulmonary tuberculosis.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Jalil Pirayesh Islamian et al.
Cancer biology & medicine, 11(2), 78-85 (2014-07-11)
Esophageal cancer has been reported as the ninth most common malignancy and ranks as the sixth most frequent cause of death worldwide. Esophageal cancer treatment involves surgery, chemotherapy, radiation therapy, or combination therapy. Novel strategies are needed to boost the
Noffisat O Oki et al.
BMC research notes, 4, 28-28 (2011-02-02)
Approximately 5-10% of persons infected with M. tuberculosis develop tuberculosis, but the factors associated with disease progression are incompletely understood. Both linkage and association studies have identified human genetic variants associated with susceptibility to pulmonary tuberculosis, but few genetic studies
Abbes Belkhiri et al.
Oncotarget, 6(3), 1348-1358 (2015-01-17)
Esophageal cancer, comprising squamous carcinoma and adenocarcinoma, is a leading cause of cancer-related death in the world. Notably, the incidence of esophageal adenocarcinoma has increased at an alarming rate in the Western world. Unfortunately, the standard first-line chemo-radiotherapeutic approaches are
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service