Skip to Content
Merck
CN

SAB2106522

Sigma-Aldrich

Anti-IGF2BP3 antibody produced in rabbit

affinity isolated antibody

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

63 kDa

species reactivity

human, guinea pig, dog, bovine

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... IGF2BP3(10643)

Immunogen

Synthetic peptide directed towards the middle region of human IGF2BP3

Biochem/physiol Actions

Igf2bp3 is a RNA-binding protein that act as a regulator of mRNA translation and stability. Igf2bp3 binds to the 5′-UTR of the insulin-like growth factor 2 (IGF2) mRNAs. Igf2bp3 binds to sequences in the 3′-UTR of CD44 mRNA.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: QQNPSPQLRGRRGPGQRGSSRQASPGSVSKQKPCDLPLRLLVPTQFVGAI

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

K Yoshino et al.
Diseases of the esophagus : official journal of the International Society for Diseases of the Esophagus, 27(5), 479-484 (2012-09-20)
Identification of reliable markers of radiosensitivity and the key molecules that donate susceptibility to anticancer treatments to esophageal cancer cells would be highly desirable. We found that the mRNA expression of insulin-like growth factor 2 mRNA-binding protein 3 (IGF2BP3) was higher
Emanuel Adelino M Damasceno et al.
Journal of cancer research and clinical oncology, 140(12), 2163-2168 (2014-10-18)
The aim of this study was to evaluate the expression of IMP3, an independent poor prognostic factor for many cancers, and its association with clinicopathological features and HER2 status. Gastrectomy specimens from 106 patients were evaluated by immunohistochemistry and fluorescence
Kazuki Takahashi et al.
Biochemical and biophysical research communications, 448(1), 22-27 (2014-04-17)
In immature zebrafish oocytes, dormant cyclin B1 mRNAs localize to the animal polar cytoplasm as aggregates. After hormonal stimulation, cyclin B1 mRNAs are dispersed and translationally activated, which are necessary and sufficient for the induction of zebrafish oocyte maturation. Besides

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service