SAB2108568
Anti-FAM107A
IgG fraction of antiserum
Synonym(s):
Anti- FLJ30158, Anti- FLJ45473, Anti- TU3A, Anti-DRR1
Sign In to View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
17 kDa
species reactivity
guinea pig, bovine, human, mouse, dog, rat
concentration
0.5-1 mg/mL
technique(s)
immunoblotting: suitable
accession no.
NM_007177
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... FAM107A(11170)
General description
FAM107A (family with sequence similarity 107 member A) is expressed at high level in the brain and heart. It has a nuclear localization signal (NLS) and a coiled domain. FAM107A has 144 amino acids and is located on human chromosome 3p14.3.
Immunogen
Synthetic peptide directed towards the middle region of human FAM107A
Application
Anti-FAM107A has been used in the quantification of DRR1 protein levels.
Biochem/physiol Actions
FAM107A (family with sequence similarity 107 member A) participates in neuronal cell survival. Overexpression of FAM107A has the ability to repress the development of tumor cells. It plays a major role in the progression of the embryo. FAM107A participates in cell invasion. This protein modulates FA dynamics and cell movement.
When FAM107A is transfected into cell lines in which it is not expressed, it suppresses cell growth. It may play a role in tumor development.
When FAM107A is transfected into cell lines in which it is not expressed, it suppresses cell growth. It may play a role in tumor development.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: RLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSE
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
FAM107A (family with sequence similarity 107, member A)
Kadomatsu K and Mu P
Atlas of Genetics and Cytogenetics in Oncology and Haematology (2011)
Tanja Jene et al.
Psychoneuroendocrinology, 91, 149-158 (2018-03-21)
Understanding the neurobiological mechanisms underlying the response to an acute stressor may provide novel insights into successful stress-coping strategies. Acute behavioral stress-effects may be restricted to a specific time window early after stress-induction. However, existing behavioral test batteries typically span
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service