biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
2F1, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL
isotype
IgG1κ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... RCC1(1104)
General description
Regulator of chromosome condensation 1 (RCC1) is a nuclear guanine nucleotide exchange factor for the small GTPase Ran enzyme. The gene is located on human chromosome 1p35.3. It is a 45 kDa protein.
Immunogen
RCC1 (AAH07300, 312 a.a. ~ 421 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS
Sequence
EGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS
Biochem/physiol Actions
Regulator of chromosome condensation 1 (RCC1) interacts with chromatin and contributes to the formation of RanGTP gradients, which is required for nucleo-cytoplasmic transport, mitotic spindle formation and nuclear envelope reassembly following mitosis. It is an important cell cycle regulator. The protein functions as a tumor suppressor in gastric carcinoma.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Epstein-Barr virus nuclear antigen 1 interacts with regulator of chromosome condensation 1 dynamically throughout the cell cycle
Deschamps T, et al.
The Journal of General Virology, 98(2), 251-265 (2017)
Methylation-silencing RCC1 expression is associated with tumorigenesis and depth of invasion in gastric cancer
Lin YL, et al.
International Journal of Clinical and Experimental Pathology, 8(11), 14257-14257 (2015)
Nuclear import of the Ran exchange factor, RCC1, is mediated by at least two distinct mechanisms
Nemergut ME, et al.
The Journal of Cell Biology, 149(4), 835-850 (2000)
Integrated analysis profiles of long non-coding RNAs reveal potential biomarkers of drug resistance in lung cancer
Xue WL, et al.
Oncotarget, 8(38), 62868-62868 (2017)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service