Skip to Content
Merck
CN

WH0002672M1

Monoclonal Anti-GFI1 antibody produced in mouse

clone 3G8, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-ZNF163, Anti-growth factor independent 1

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
MDL number:
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

Product Name

Monoclonal Anti-GFI1 antibody produced in mouse, clone 3G8, purified immunoglobulin, buffered aqueous solution

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3G8, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

Gene Information

human ... GFI1(2672)

Biochem/physiol Actions

Growth factor independent protein 1 (GFI1) regulates lymphomagenesis and differentiation of hematopoietic and non-hematopoietic tissues especially those associated with lungs, intestine, and inner ear hair cells. It acts as a transcriptional repressor protein that recruits histone demethylase complex (LSD-1) and histone deacetylases. Gfi1 serves as a mediator of the cell cycle and apoptosis. It favors multiple myeloma tumor progression and chemoresistance. Mutation in the GFI1 gene is implicated in severe congenital neutropenia (SCN).

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

Growth factor independent protein 1 (GFI1) is a zinc finger DNA-binding protein with an N-terminal SNAIL/Gfi-1 (SNAG) domain and C-terminal Zinc finger motifs. The GFI1 gene is mapped to human chromosome 1p22.1.

Immunogen

GFI1 (NP_005254, 1 a.a. ~ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASASPRQLRSSVCERSSEFEDFWR

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Eduardo Anguita et al.
Frontiers in oncology, 7, 54-54 (2017-04-13)
Many human diseases arise through dysregulation of genes that control key cell fate pathways. Transcription factors (TFs) are major cell fate regulators frequently involved in cancer, particularly in leukemia. The GFI1B gene, coding a TF, was identified by sequence homology
Ji Un Kang et al.
International journal of oncology, 36(6), 1429-1435 (2010-04-30)
Homozygous deletions (HDs) are major genomic forces contributing to the development of many solid tumors. To identify critical tumor-suppressor loci involved in the pathogenesis of gastric carcinoma (GC), a high-resolution microarray-CGH was performed in a series of 27 GC patients.
Nadia Ashour et al.
International journal of molecular sciences, 21(13) (2020-07-08)
Prostate and breast cancer constitute the most common cancers among men and women worldwide. The aging population is one of the main risk factors for prostate and breast cancer development and accumulating studies link aging with epigenetic changes. Growth factor
Daniela N Petrusca et al.
Journal of hematology & oncology, 11(1), 123-123 (2018-10-06)
In spite of major advances in treatment, multiple myeloma (MM) is currently an incurable malignancy due to the emergence of drug-resistant clones. We previously showed that MM cells upregulate the transcriptional repressor, growth factor independence 1 (Gfi1), in bone marrow

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service