WH0004062M1
Monoclonal Anti-LY6H antibody produced in mouse
clone 3E10, purified immunoglobulin, buffered aqueous solution
Synonym(s):
Anti-NMLY6, Anti-lymphocyte antigen 6 complex, locus H
Sign In to View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
3E10, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG1κ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... LY6H(4062)
General description
Lymphocyte antigen-6 family member H (LY6H) protein belongs to the lymphocyte antigen-6 (LY6) family. It is expressed at a high level in the brain. LY6H gene is located on human chromosome 8q24.3.
Immunogen
LY6H (AAH28894, 26 a.a. ~ 140 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP
Sequence
LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP
Biochem/physiol Actions
Lymphocyte antigen-6 family member H (LY6H) protein might participates in the central nervous system and the immune system. It is involved in glutamatergic signaling in the brain. LY6H regulates α7 nicotinic acetylcholine receptor (nAChR) signaling. Overexpression of LY6H is linked with poor survival in colorectal, ovarian, colorectal, gastric, breast, and lung cancer. Hence, LY6H might be preferred in targeted cancer therapy.
Features and Benefits
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
M Horie et al.
Genomics, 53(3), 365-368 (1998-11-04)
The Ly6 family of genes encodes glycosylphosphatidylinositol-anchored cell surface glycoproteins expressed on various types of cells. Intriguing patterns of expression of Ly6 genes on specific subpopulations of lymphoid and myeloid cells suggest that Ly6 molecules may be involved in the
Geeta Upadhyay
Frontiers in immunology, 10, 819-819 (2019-05-10)
Stem Cell Antigen-1 (Sca-1/Ly6A) was the first identified member of the Lymphocyte antigen-6 (Ly6) gene family. Sca-1 serves as a marker of cancer stem cells and tissue resident stem cells in mice. The Sca-1 gene is located on mouse chromosome
R Matsuda et al.
British journal of cancer, 104(2), 376-386 (2010-11-11)
The aim of this study is to find a novel molecular target based on chromosomal alteration and array-based gene expression analyses in bladder cancer (BC). We investigated a cancer testis antigen, LY6K, which is located on chromosome 8q24.3. Five BC
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service