WH0004586M7
Monoclonal Anti-MUC5AC antibody produced in mouse
clone 2H7, purified immunoglobulin, buffered aqueous solution
Synonym(s):
Anti-MUC5, Anti-mucin 5, subtypes A and C, tracheobronchial/gastric
biological source
mouse
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
2H7, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
indirect ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG1κ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... MUC5AC(4586)
General description
Mucin 5AC (MUC5AC) is encoded by the gene mapped to human chromosome 11p15.5 and is predominantly expressed in the gastric and tracheobronchial mucosae. The MUC5AC protein contains two types of deduced peptide domains such as eight amino acid tandemly repeated (TR) domains and cysteine-rich domains.
Immunogen
MUC5AC (XP_495860, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NQSTCAVYHRSLIIQQQGCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEHRCQCCQELRTSLRNVTLHCTDGSSRAFSYTEVEECGCMGRRCPAPGDTQH
Sequence
NQSTCAVYHRSLIIQQQGCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEHRCQCCQELRTSLRNVTLHCTDGSSRAFSYTEVEECGCMGRRCPAPGDTQH
Biochem/physiol Actions
Increased expression of Mucin 5AC (MUC5AC) leads to epithelial cancer progression, including colon cancer. Therefore, MUC5AC is considered to be a potential target in the treatment of colon cancer. MUC5AC containing the carbohydrate blood-group antigen, Lewis B (LeB) functions as a key receptor for Helicobacter pylori. O-glycoprotein encoded by the gene plays a vital role in mucus formation and epithelium protection. Decreased level of MUC5AC expression in ocular surface might lead to the tear instability in patients with SjÖgren syndrome.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
A E Biemer-Hüttmann et al.
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society, 47(8), 1039-1048 (1999-07-29)
We studied the distribution of the four human apomucins MUC1, MUC2, MUC4, and MUC5AC in hyperplastic polyps, serrated adenomas, and traditional adenomas of the colorectum using immunohistochemical techniques, with the aim of comparing and contrasting their patterns of expression. A
Erica Kosmerl et al.
Nutrients, 16(7) (2024-04-13)
The goblet cells of the gastrointestinal tract (GIT) produce glycoproteins called mucins that form a protective barrier from digestive contents and external stimuli. Recent evidence suggests that the milk fat globule membrane (MFGM) and its milk phospholipid component (MPL) can
Pablo Argüeso et al.
Investigative ophthalmology & visual science, 43(4), 1004-1011 (2002-03-30)
To determine whether the relative amounts of mucin mRNA in the conjunctival epithelium and mucin protein in the tears are altered in patients with Sjögren syndrome compared with healthy individuals. Tear fluid was collected from the inferior fornix of normal
V Guyonnet Duperat et al.
The Biochemical journal, 305 ( Pt 1), 211-219 (1995-01-01)
To date five human mucin cDNAs (MUC2, 5A, 5B, 5C and 6) mapped to 11p15.3-15.5, so it appears that this chromosome region might contain several distinct gene loci for mucins. Three of these cDNAs, MUC5A, B and C, were cloned
Xijia Zhu et al.
Cancer biotherapy & radiopharmaceuticals, 31(7), 261-267 (2016-09-10)
Deregulated expressions of mucins have been found in various malignancies and play a pivotal role in carcinogenesis. MUC5AC, as a secreted mucin, is reported to be aberrantly expressed during epithelial cancer progression, including colon cancer. However, the mechanisms of the
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service