biological source
mouse
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
3B2, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
ELISA: suitable
immunofluorescence: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: 1-5 μg/mL
isotype
IgG1κ
GenBank accession no.
UniProt accession no.
application(s)
research pathology
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... NPM1(4869)
General description
NPM1 is a ubiquitously expressed nucleolar protein that shuttles between the nucleus and cytoplasm. It is implicated in multiple functions, including ribosomal protein assembly and transport, control of centrosome duplication, and regulation of the tumor suppressor ARF (MIM 600160). NPM1 mutations that relocalize NPM1 from the nucleus into the cytoplasm are associated with development of acute myeloid leukemia (AML; MIM 601626) (Garzon et al., 2008 [PubMed 18308931]).[supplied by OMIM]
Nucleophosmin 1 (NPM1) is an important multifunctional protein mainly located in the nucleolus. This gene is located on human chromosome 5q35.
Nucleophosmin 1 (NPM1) is an important multifunctional protein mainly located in the nucleolus. This gene is located on human chromosome 5q35.
Immunogen
NPM1 (AAH02398.1, 1 a.a. ~ 294 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
Sequence
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
Application
Monoclonal Anti-NPM1 antibody produced in mouse has been used in immunoblotting.
The antibody may be used for ELISA, competitive ELISA, immunoblotting (37 kDa), immunoprecipitation, immunohistochemistry, immunocytochemistry (2% formaldehyde-acetone 1,2,5 or 10% formalin/methanol-1% NP-40 and microinjection (blocks the initiation of centrosome duplication). Reactivity has been observed with human, monkey, bovine, dog, hamster (weak), rat,kangaroo rat, and mouse B23.
Biochem/physiol Actions
NPM1 (nucleophosmin 1) induces cell proliferation. It increases migration and invasion of cells.
NPM1 (nucleophosmin 1) induces cell proliferation. It increases migration and invasion of cells. Mutations in NPM1 result in acute myeloid leukemia (AML).
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
NPM1 Deletion Is Associated with Gross Chromosomal Rearrangements in Leukemia.
Starza RL, et al.
PLoS ONE, 5(9), e12855-e12855 (2010)
Localization of AML-related nucleophosmin mutant depends on its subtype and is highly affected by its interaction with wild-type NPM.
Brodska B, et al.
PLoS ONE, 12(4), e0175175-e0175175 (2017)
Dynamic localization of alpha-tubulin acetyltransferase ATAT1 through the cell cycle in human fibroblastic KD cells
Nekooki-Machida, et al.
Medical Molecular Morphology, 1-10 (2018)
Relocation of NPM Affects the Malignant Phenotypes of Hepatoma SMMC-7721 Cells.
Li X, et al.
Journal of Cellular Biochemistry, 118(10), 3225-3236 (2017)
The linker histone H1. 2 is a novel component of the nucleolar organizer regions
Junjie C, et al.
The Journal of Biological Chemistry, M117-M117 (2018)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service