Skip to Content
Merck
CN

WH0009641M2

Monoclonal Anti-IKBKE antibody produced in mouse

clone 2F1, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-IKKE, Anti-IKKI, Anti-IKKi, Anti-KIAA0151, Anti-MGC125294, Anti-MGC125295, Anti-MGC125297, Anti-inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

NACRES:
NA.41
UNSPSC Code:
12352203
Conjugate:
unconjugated
Clone:
2F1, monoclonal
Application:
ELISA (i)
Citations:
6
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2F1, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

Gene Information

human ... IKBKE(9641)

General description

Inhibitor of κ light polypeptide gene enhancer in B-cells, kinase ε (IKKε ) is encoded by the gene mapped to human chromosome 1q32.1. IKKε is a serine/threonine protein kinase, which belongs to the non-canonical IκB kinase family. IKKε is an ~85kDa protein characterized with kinase domain close to N-terminal end, coiled-coil motif, and putative helix-loop-helix (HLH) motif close to C-terminal end.

Immunogen

IKBKE (NP_054721, 541 a.a. ~ 640 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QQIQCYLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQE

Biochem/physiol Actions

Inhibitor of κ light polypeptide gene enhancer in B-cells, kinase ε (IKKε) mainly activates the canonical nuclear factor-κB (NF-κB) pathway induced by interferon, phorbol 12-myristate 13-acetate, or the T-cell receptor. Overexpression of IKKε is associated with the pathogenesis of a subset of breast tumors and ovarian cancer. IKBKE also acts as a potential therapeutic target for these malignancies. IKKε plays a vital role in regulation of immune response. IKKε is an essential constituent of a novel IκB kinase complex, which is mainly implicated in the degradation of IκBα in response to either phorbol esters (PMA) or to T cell receptor activation. IKKε activated by interferon-β (IFNβ), directly phosphorylates signal transducer and activator of transcription 1 (STAT1), a component of interferon-stimulated gene factor 3 complex (ISGF3), and thus, plays a vital role in IFN-inducible antiviral transcriptional response.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Jesse S Boehm et al.
Cell, 129(6), 1065-1079 (2007-06-19)
The karyotypic chaos exhibited by human epithelial cancers complicates efforts to identify mutations critical for malignant transformation. Here we integrate complementary genomic approaches to identify human oncogenes. We show that activation of the ERK and phosphatidylinositol 3-kinase (PI3K) signaling pathways
Benjamin R Tenoever et al.
Science (New York, N.Y.), 315(5816), 1274-1278 (2007-03-03)
IKKepsilon is an IKK (inhibitor of nuclear factor kappaBkinase)-related kinase implicated in virus induction of interferon-beta (IFNbeta). We report that, although mice lacking IKKepsilon produce normal amounts of IFNbeta, they are hypersusceptible to viral infection because of a defect in
Masuko Katoh et al.
International journal of molecular medicine, 11(6), 791-797 (2003-05-09)
Parallel analyses of DNA copy number and mRNA expression level by using microarray measurements have been successfully applied for genome-wide screening of proto-oncogenes and tumor suppressor genes. The uncharacterized KIAA0456 cDNA was reported amplified and overexpressed in human breast cancer
Jian-Ping Guo et al.
The American journal of pathology, 175(1), 324-333 (2009-06-06)
I-kappa-B kinase e (IKBKE; IKKepsilon) has been recently identified as a breast cancer oncogene, and its alteration appears to be an early event in breast cancer development. In this study, we demonstrated that IKKepsilon is frequently overexpressed and activated in
J Guo et al.
Oncogene, 32(2), 151-159 (2012-02-15)
Serine/threonine kinase IKBKE is a newly identified oncogene; however, its regulation remains elusive. Here, we provide evidence that IKBKE is a downstream target of signal transducer and activator of transcription 3 (STAT3) and that tobacco components induce IKBKE expression through

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service