Monoclonal Anti-IKBKE antibody produced in mouse

Inhibitor of κ light polypeptide gene enhancer in B-cells, kinase ε (IKKε ) is encoded by the gene mapped to human chromosome 1q32.1. IKKε is a serine/threonine protein kinase, which belongs to the non-canonical IκB kinase family. IKKε is an ~85kDa protein characterized with kinase domain close to N-terminal end, coiled-coil motif, and putative helix-loop-helix (HLH) motif close to C-terminal end.

IKBKE (NP_054721, 541 a.a. ~ 640 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QQIQCYLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQE

Inhibitor of κ light polypeptide gene enhancer in B-cells, kinase ε (IKKε) mainly activates the canonical nuclear factor-κB (NF-κB) pathway induced by interferon, phorbol 12-myristate 13-acetate, or the T-cell receptor. Overexpression of IKKε is associated with the pathogenesis of a subset of breast tumors and ovarian cancer. IKBKE also acts as a potential therapeutic target for these malignancies. IKKε plays a vital role in regulation of immune response. IKKε is an essential constituent of a novel IκB kinase complex, which is mainly implicated in the degradation of IκBα in response to either phorbol esters (PMA) or to T cell receptor activation. IKKε activated by interferon-β (IFNβ), directly phosphorylates signal transducer and activator of transcription 1 (STAT1), a component of interferon-stimulated gene factor 3 complex (ISGF3), and thus, plays a vital role in IFN-inducible antiviral transcriptional response.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services