WH0009641M2
Monoclonal Anti-IKBKE antibody produced in mouse
clone 2F1, purified immunoglobulin, buffered aqueous solution
Synonym(s):
Anti-IKKE, Anti-IKKI, Anti-IKKi, Anti-KIAA0151, Anti-MGC125294, Anti-MGC125295, Anti-MGC125297, Anti-inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon
Sign In to View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
2F1, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
indirect ELISA: suitable
isotype
IgG1κ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... IKBKE(9641)
General description
Inhibitor of κ light polypeptide gene enhancer in B-cells, kinase ε (IKKε ) is encoded by the gene mapped to human chromosome 1q32.1. IKKε is a serine/threonine protein kinase, which belongs to the non-canonical IκB kinase family. IKKε is an ~85kDa protein characterized with kinase domain close to N-terminal end, coiled-coil motif, and putative helix-loop-helix (HLH) motif close to C-terminal end.
Immunogen
IKBKE (NP_054721, 541 a.a. ~ 640 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QQIQCYLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQE
Sequence
QQIQCYLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQE
Biochem/physiol Actions
Inhibitor of κ light polypeptide gene enhancer in B-cells, kinase ε (IKKε) mainly activates the canonical nuclear factor-κB (NF-κB) pathway induced by interferon, phorbol 12-myristate 13-acetate, or the T-cell receptor. Overexpression of IKKε is associated with the pathogenesis of a subset of breast tumors and ovarian cancer. IKBKE also acts as a potential therapeutic target for these malignancies. IKKε plays a vital role in regulation of immune response. IKKε is an essential constituent of a novel IκB kinase complex, which is mainly implicated in the degradation of IκBα in response to either phorbol esters (PMA) or to T cell receptor activation. IKKε activated by interferon-β (IFNβ), directly phosphorylates signal transducer and activator of transcription 1 (STAT1), a component of interferon-stimulated gene factor 3 complex (ISGF3), and thus, plays a vital role in IFN-inducible antiviral transcriptional response.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Masuko Katoh et al.
International journal of molecular medicine, 11(6), 791-797 (2003-05-09)
Parallel analyses of DNA copy number and mRNA expression level by using microarray measurements have been successfully applied for genome-wide screening of proto-oncogenes and tumor suppressor genes. The uncharacterized KIAA0456 cDNA was reported amplified and overexpressed in human breast cancer
J Guo et al.
Oncogene, 32(2), 151-159 (2012-02-15)
Serine/threonine kinase IKBKE is a newly identified oncogene; however, its regulation remains elusive. Here, we provide evidence that IKBKE is a downstream target of signal transducer and activator of transcription 3 (STAT3) and that tobacco components induce IKBKE expression through
Jian-Ping Guo et al.
The American journal of pathology, 175(1), 324-333 (2009-06-06)
I-kappa-B kinase e (IKBKE; IKKepsilon) has been recently identified as a breast cancer oncogene, and its alteration appears to be an early event in breast cancer development. In this study, we demonstrated that IKKepsilon is frequently overexpressed and activated in
R T Peters et al.
Molecular cell, 5(3), 513-522 (2000-07-06)
Here we report the identification of a novel PMA-inducible IkappaB kinase complex, distinct from the well-characterized high-molecular weight IkappaB kinase complex containing IKKalpha, IKKbeta, and IKKgamma. We have characterized one kinase from this complex, which we designate IKKepsilon. Although recombinant
Jesse S Boehm et al.
Cell, 129(6), 1065-1079 (2007-06-19)
The karyotypic chaos exhibited by human epithelial cancers complicates efforts to identify mutations critical for malignant transformation. Here we integrate complementary genomic approaches to identify human oncogenes. We show that activation of the ERK and phosphatidylinositol 3-kinase (PI3K) signaling pathways
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service