Skip to Content
Merck
CN

WH0056913M1

Sigma-Aldrich

Monoclonal Anti-C1GALT1 antibody produced in mouse

clone 1F1, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-C1GALT, Anti-Tsynthase, Anti-core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1F1, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... C1GALT1(56913)

General description

Glycoprotein-N- acetylgalactosamine 3-β- galactosyltransferase 1 (C1GALT1) is localized in the Golgi apparatus. The gene encoding it contains three exons spanning 10 kb. It is located on chromosome 7p14-p13.

Immunogen

C1GALT1 (NP_064541, 264 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANKNEDTKVKLGNP

Biochem/physiol Actions

Glycoprotein-N- acetylgalactosamine 3-β- galactosyltransferase 1 (C1GALT1) functions in the addition of galactose onto GalNAc residues of IgA1. Thus, it generates the core 1 O-glycan Galβ1-3GalNAα1-SerThr (T antigen), which is a precursor for many extended O-glycans in glycoproteins. A deficiency of C1GALT1 results in IgA nephropathy, Tn syndrome and also Henoch-Schönlein purpura. It increases the proliferation of hepatocellular carcinoma cells by regulating MET glycosylation and dimerization. C1GALT1 also regulates angiogenesis, kidney development and thrombopoiesis.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

C1GALT1 enhances proliferation of hepatocellular carcinoma cells via modulating MET glycosylation and dimerization.
Wu YM, et.al
Cancer Research, 73(17), 5580-5590 (2013)
Variants of C1GALT1 gene are associated with the genetic susceptibility to IgA nephropathy.
Li GS, et.al
Kidney International, 71(5), 448-453 (2007)
Variants of C1GALT1 gene are associated with the genetic susceptibility to IgA nephropathy.
Li GS, et al.
Kidney International, 71(5), 448-453 (2007)
Tongzhong Ju et al.
Proceedings of the National Academy of Sciences of the United States of America, 99(26), 16613-16618 (2002-12-05)
Human core 1 beta3-galactosyltransferase (C1beta3Gal-T) generates the core 1 O-glycan Galbeta1-3GalNAcalpha1-SerThr (T antigen), which is a precursor for many extended O-glycans in animal glycoproteins. We report here that C1beta3Gal-T activity requires expression of a molecular chaperone designated Cosmc (core 1
Li Zhu et al.
Kidney international, 76(2), 190-198 (2009-04-10)
Increasing evidence points to the importance of aberrant O-glycosylated immunoglobulin A1 (IgA1) in the pathogenesis of IgA nephropathy (IgAN), a disease widely considered to be a polygenic disorder. We earlier found that haplotypes in two key glycosyltransferase genes, C1GALT1 and

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service