Skip to Content
Merck
CN

374090

Sigma-Aldrich

Anti-Heme Oxygenase-1 (1-30) Rabbit pAb

liquid, Calbiochem®

Synonym(s):

Anti-HO-1, Anti-Hsp32

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

antibody form

purified antibody

antibody product type

primary antibodies

clone

polyclonal

form

liquid

contains

≤0.1% sodium azide as preservative

species reactivity

human, hamster, monkey, mouse, rat, canine

manufacturer/tradename

Calbiochem®

storage condition

OK to freeze
avoid repeated freeze/thaw cycles

dilution

(Immunoblotting (1:1000, chemiluminescence)
Immunoprecipitation (1:100))

isotype

IgG

shipped in

ambient

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... HMOX1(3162)

General description

Anti-Heme Oxygenase-1 (1-30), rabbit polyclonal, recognizes the ~32 kDa HO-1 protein. Does not cross-react with HO-2. It is validated for use in Western blotting and immunoprecipitation.
Protein A purified rabbit polyclonal antibody. Recognizes the ~32 kDa HO-1 protein.
Recognizes the ~32 kDa HO-1 protein. Does not cross-react with HO-2.

Immunogen

Human
a synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide

Application

Immunoblotting (1:1000, chemiluminescence)

Immunoprecipitation (1:100)

Physical form

In PBS, 50% glycerol, pH 7.2.

Preparation Note

Following initial thaw, aliquot and freeze (-20°C).

Other Notes

Does not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.
Maines, M.D. 1988 FASEB J.2, 2557.
Kutty, R.K., et al. 1994. J. Cell Physiol.159, 371.
Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
Trakshel, G.M., et al. 1986 J. Biol. Chem.261, 11131.

Legal Information

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Toxicity: Standard Handling (A)

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Seon Yeong Ji et al.
Biomolecules & therapeutics, 29(6), 685-696 (2021-04-07)
In this study, we investigated the inhibitory effect of 5-aminolevulinic acid (ALA), a heme precursor, on inflammatory and oxidative stress activated by lipopolysaccharide (LPS) in RAW 264.7 macrophages by estimating nitric oxide (NO), prostaglandin E2 (PGE2), cytokines, and reactive oxygen
Dong-Sung Lee et al.
Molecular medicine reports, 15(1), 451-459 (2016-12-14)
Liver diseases are considered to be primary contributors to morbidity and mortality rates in humans. Oxidative stress is critical in liver injury, and oxidant‑induced liver injury may be caused by toxins, including tert‑butyl hydroperoxide (t‑BHP). The present study investigated the
Da Hye Kwon et al.
International journal of molecular medicine, 41(1), 264-274 (2017-11-09)
Schisandrin A is a bioactive lignan occurring in the fruits of plants of the Schisandra genus that have traditionally been used in Korea for treating various inflammatory diseases. Although the anti-inflammatory and antioxidant effects of lignan analogues similar to schisandrin A have
Jin-Woo Jeong et al.
Foods (Basel, Switzerland), 8(8) (2019-07-31)
Sea tangle (Laminaria japonica Aresch), a brown alga, has been used for many years as a functional food ingredient in the Asia-Pacific region. In the present study, we investigated the effects of fermented sea tangle extract (FST) on receptor activator
Chia-Wen Lo et al.
Environmental toxicology, 39(8), 4120-4133 (2024-04-24)
Lipotoxicity leads to numerous metabolic disorders such as nonalcoholic steatohepatitis. Luteolin, apigenin, and chrysin are three flavones with known antioxidant and anti-inflammatory properties, but whether they inhibit lipotoxicity-mediated NLRP3 inflammasome activation was unclear. To address this question, we used J774A.1

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service