biological source
human
Quality Segment
recombinant
expressed in E. coli
description
0.1 mg recombinant human CD270 in 20 mM Tris-HCl buffer, containing NaCl, KCl, EDTA, L-arginine, DTT and glycerol.
sterility
Filtered sterilized solution
assay
≥90% (SDS-PAGE)
form
liquid
packaging
pkg of 100 μg
concentration
0.5 mg protein/mL
accession no.
NP_003811.2
UniProt accession no.
storage temp.
−20°C
Gene Information
human ... TNFRSF14(8764)
Application
Coating a plate well (6 well plate) with this recombinant CD270 protein in a specific culture medium at 5-10 μg/well allows for use 1) as a coating matrix protein for human T or B cell functions and differentiation regulation studies in vitro, 2) as potential biomarker protein for infectious diseases and auto-immuno disease diagnostic development, or 3) as an antigen for specific antibody production.
Use this procedure as a guideline to determine optimal coating conditions for the culture system of choice.
1. Thaw CD270 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so the volume added covers the surface evenly (1-10 μg/well, 6 well plate).
2. Add appropriate amount of diluted material to culture surface.
3. Incubate at room temperature for approximately 1.5 hours.
4. Aspirate remaining material.
5. Rinse plates carefully with water and avoid scratching bottom surface of plates.
6. Plates are ready for use. They may also be stored at 2-8 °C damp or air dried if sterility is maintained.
Use this procedure as a guideline to determine optimal coating conditions for the culture system of choice.
1. Thaw CD270 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so the volume added covers the surface evenly (1-10 μg/well, 6 well plate).
2. Add appropriate amount of diluted material to culture surface.
3. Incubate at room temperature for approximately 1.5 hours.
4. Aspirate remaining material.
5. Rinse plates carefully with water and avoid scratching bottom surface of plates.
6. Plates are ready for use. They may also be stored at 2-8 °C damp or air dried if sterility is maintained.
Preparation Note
The extracellular domain of recombinant human CD270 (39 - 202 aa) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal and expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified.
Other Notes
MASMTGGQQMGRGHHHHHHGNLYFQG^GEFLPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWV
存储类别
10 - Combustible liquids
wgk
WGK 2
flash_point_f
Not applicable
flash_point_c
Not applicable