AV07056
Anti-CMKLR1 antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-Chemokine-like receptor 1
Sign In to View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
42 kDa
species reactivity
human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified, unmodified
Gene Information
human ... CMKLR1(1240)
Related Categories
Immunogen
Synthetic peptide directed towards the C terminal region of human CMKLR1
Application
Anti-CMKLR1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.
Biochem/physiol Actions
CMKLR1 is a G-protein coupled receptor that is activated by chemerine, a leukocyte attractant and adipokine. CMKLR1 is expressed in embryonic and adult skeletal muscle, though its role in adults is not clear. It regulates the processes of cell migration and differentiation of myoblasts into myotubes. The role of this receptor is important in adipose tissue development, inflammation, and glucose homeostasis.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: KKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETGML
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Matthew C Ernst et al.
Endocrinology, 153(2), 672-682 (2011-12-22)
Adipose tissue secretes a variety of bioactive signaling molecules, termed adipokines, which regulate numerous biological functions including appetite, energy balance, glucose homeostasis, and inflammation. Chemerin is a novel adipokine that regulates adipocyte differentiation and metabolism by binding to and activating
Mark E Issa et al.
American journal of physiology. Cell physiology, 302(11), C1621-C1631 (2012-03-31)
The chemokine-like receptor-1 (CMKLR1) is a G protein-coupled receptor that is activated by chemerin, a secreted plasma leukocyte attractant and adipokine. Previous studies identified that CMKLR1 is expressed in skeletal muscle in a stage-specific fashion during embryogenesis and in adult
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service