Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
NACRES:
NA.41
UNSPSC Code:
12352203
Product Name
Anti-SFRP1 antibody produced in rabbit, IgG fraction of antiserum
biological source
rabbit
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
35 kDa
species reactivity
mouse, human, guinea pig, horse, dog, rat
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... SFRP1(6422)
Application
Anti-SFRP1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.3 μg/ml.
Biochem/physiol Actions
Secreted Frizzled-related protein 1 (SFRP1) is a secreted antagonist of Wnt signaling pathway. It is secreted in excess amounts during DNA damage- or oxidative stress-induced cellular senescence. SFRP1 is a modulator of normal and malignant hematopoiesis and cell proliferation. Gene polymorphisms, aberrations and methylation of SFRP1 is a feature in bladder cancers resulting in excessive activation of Wnt pathway.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the middle region of human SFRP1
Other Notes
Synthetic peptide located within the following region: HQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPT
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Anja Rogler et al.
International journal of clinical and experimental pathology, 6(10), 1984-1998 (2013-10-18)
In this study, we determined the genotype distribution of two single nucleotide polymorphisms (SNPs) in secreted frizzled related protein 1 (SFRP1), rs3242 and rs921142, in a Caucasian bladder cancer case-control study. Allelic variants of the SNPs were determined using restriction
Chi Keung Cheng et al.
Blood, 118(25), 6638-6648 (2011-10-28)
Secreted-frizzled related proteins (SFRPs) are modulators of the Wnt signaling pathway that is closely involved in normal and malignant hematopoiesis. Epigenetic deregulation of Wnt modulators leading to aberrant signaling has been reported in adult patients with acute myeloid leukemia (AML)
Yange Wang et al.
Frontiers in cellular and infection microbiology, 10, 101-101 (2020-04-02)
Schistosomiasis remains a serious parasitic disease, which is characterized by granulomatous inflammation and hepatic fibrosis. MicroRNAs derived from parasites can regulate host genes and cell phenotype. Here, we showed that a miRNA derived from S. japonicum (Sja-miR-1) exists in the
Xiaobin Wang et al.
Oncology letters, 4(2), 334-338 (2012-07-31)
The aims of this study were to determine the methylation and expression status of secreted Frizzled-related protein 1 (SFRP1) in bladder cancer, to explore the mechanisms involved and to study the role of SFRP1 in the pathogenesis of bladder cancer.
David J Elzi et al.
Molecular and cellular biology, 32(21), 4388-4399 (2012-08-29)
Cellular senescence has emerged as a critical tumor suppressive mechanism in recent years, but relatively little is known about how senescence occurs. Here, we report that secreted Frizzled-related protein 1 (SFRP1), a secreted antagonist of Wnt signaling, is oversecreted upon
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service