Skip to Content
Merck
CN

AV100771

Sigma-Aldrich

Anti-TCF12 (AB2) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-HEB, Anti-HTF4, Anti-HsT17266, Anti-Transcription factor 12 (HTF4, helix-loop-helix Transcription factors 4)

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

73 kDa

species reactivity

pig, bovine, human, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TCF12(6938)

Related Categories

General description

TCF12 belongs to the Tcf family of transcription factors that activate genes induced by the Wnt pathway.

Immunogen

Synthetic peptide directed towards the N terminal region of human TCF12

Application

Anti-TCF12 (AB2) antibody produced in rabbit rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Biochem/physiol Actions

TCF12 suppresses the expression of E-cadherin mRNA in metastatic colorectal cancer cells. The overexpression of TCF12 facilitates cell migration and invasion of these cells. TCF12 has a possible role in maintaining neural stem cells and progenitor cells in undifferentiated state during neurogenesis.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: QQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGIDE

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

M Uittenbogaard et al.
Brain research. Gene expression patterns, 1(2), 115-121 (2004-03-17)
In this study, we focused on the potential function of the murine gene Tcf12 (also known as ME1 or HEB) encoding the bHLH E-protein ME1 during brain development. An exencephaly phenotype of low penetrance has consistently been observed in both
Chun-Chung Lee et al.
The Journal of biological chemistry, 287(4), 2798-2809 (2011-12-02)
A correlation of TCF12 mRNA overexpression with colorectal cancer (CRC) metastasis was suggested by microarray data and validated by the survey of 120 patients. Thirty-three (27.5%) of the 120 patients showed tumor TCF12 mRNA overexpression and had a higher rate

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service