AV13019
Anti-CHRNA9 antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-Cholinergic receptor, nicotinic, α-9 (muscle)
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
55 kDa
species reactivity
guinea pig, horse, human, bovine, dog, rabbit
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human  ...  CHRNA9(55584)   
Immunogen
Synthetic peptide directed towards the N terminal region of human CHRNA9
Application
Anti-CHRNA9 antibody produced in rabbit is suitable for western blotting at a concentration of 0.0625 μg/ml.
Biochem/physiol Actions
CHRNA9 is a transmembrane oligomeric ligand-gated nicotinic receptor that induces ion channel opening for the movement of positive ions when it is activated by cholinergic binding. Nicotinic acetylcholine receptors mediate presynaptic, postsynaptic and extrasynaptic signaling. The expression of CHRNA9 receptor has been observed to be elevated in human breast epithelial cells during tumorigenesis. CHRNA9 has been implicated in stress-induced functional plasticity of rat adrenal medulla.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region:  MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVE
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Chia-Hwa Lee et al.
Journal of the National Cancer Institute, 102(17), 1322-1335 (2010-08-25)
Large epidemiological cohort studies in the United States have indicated that active and passive smoking are associated with increased breast cancer risk. However, there was no direct evidence of an effect of tobacco carcinogens on the cellular molecules involved in
Claude Colomer et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 30(19), 6732-6742 (2010-05-14)
An increase in circulating adrenal catecholamine levels constitutes one of the mechanisms whereby organisms cope with stress. Accordingly, stimulus-secretion coupling within the stressed adrenal medullary tissue undergoes persistent remodeling. In particular, cholinergic synaptic neurotransmission between splanchnic nerve terminals and chromaffin
Inmaculada Posadas et al.
Current neuropharmacology, 11(3), 298-314 (2013-11-02)
Many studies have focused on expanding our knowledge of the structure and diversity of peripheral and central nicotinic receptors. Nicotinic acetylcholine receptors (nAChRs) are members of the Cys-loop superfamily of pentameric ligand-gated ion channels, which include GABA (A and C)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service