Sign In to View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.43
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
25 kDa
species reactivity
bovine, dog, rabbit, mouse, horse, human, guinea pig, rat, sheep
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... YEATS4(8089)
General description
YEATS4 is an oncogene that negatively regulates the p21-p53 pathway. Amplification of YEATS4 has been linked to the pathogenesis of non-small cell lung cancers (NSCLC).
Rabbit Anti-YEATS4 antibody recognizes chicken, bovine, zebrafish, canine, human, mouse, and rat YEATS4.
Rabbit Anti-YEATS4 antibody recognizes chicken, bovine, zebrafish, canine, human, mouse, and rat YEATS4.
Immunogen
Synthetic peptide directed towards the middle region of human YEATS4
Application
Rabbit Anti-YEATS4 antibody can be used for western blot (0.5μg/ml) and immunohistochemistry (4-8μg/ml, using paraffin-embedded tissues) assays.
Biochem/physiol Actions
YEATS4 is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: SRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRET
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Larissa A Pikor et al.
Cancer research, 73(24), 7301-7312 (2013-10-31)
Genetic analyses of lung cancer have helped found new treatments in this disease. We conducted an integrative analysis of gene expression and copy number in 261 non-small cell lung cancers (NSCLC) relative to matched normal tissues to define novel candidate
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service