Skip to Content
Merck
CN

AV31476

Sigma-Aldrich

Anti-CDX2 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Caudal type homeobox transcription factor 2

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

34 kDa

species reactivity

human, bovine, rabbit, mouse, rat, guinea pig, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CDX2(1045)

General description

Cdx2 is a homeobox gene that regulates trophectoderm differentiation and cell fate decisions in mouse blastocysts. CDX2 expression has also been linked to intestinal metaplasia and gastric carcinogenesis.
Rabbit Anti-CDX2 antibody recognizes canine, chicken, human, mouse, rat, and pig CDX2.

Immunogen

Synthetic peptide directed towards the middle region of human CDX2

Application

Rabbit Anti-CDX2 antibody can be used for western blot assays at a concentration of 0.5μg/ml.

Biochem/physiol Actions

CDX2 encodes a protein that plays an important role in gallbladder carcinogenesis with intestinal differentiation. Cdx2 is a highly sensitive marker for Barrett′s esophagus.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: QRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRY

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Yun-Qing Bai et al.
Cancer letters, 176(1), 47-55 (2002-01-16)
The roles of CDX2 and CDX1 homeobox genes during gastric carcinogenesis remain poorly defined. We have studied the expression of CDX2/1 in gastric cancers and intestinal metaplasia (IM) of 69 gastric carcinoma patients by immunohistochemistry. CDX2/1 were shown to be
Dan Strumpf et al.
Development (Cambridge, England), 132(9), 2093-2102 (2005-03-25)
Blastocyst formation marks the segregation of the first two cell lineages in the mammalian preimplantation embryo: the inner cell mass (ICM) that will form the embryo proper and the trophectoderm (TE) that gives rise to the trophoblast lineage. Commitment to

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service