AV31476
Anti-CDX2 antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-Caudal type homeobox transcription factor 2
Sign In to View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
34 kDa
species reactivity
human, bovine, rabbit, mouse, rat, guinea pig, dog
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CDX2(1045)
General description
Cdx2 is a homeobox gene that regulates trophectoderm differentiation and cell fate decisions in mouse blastocysts. CDX2 expression has also been linked to intestinal metaplasia and gastric carcinogenesis.
Rabbit Anti-CDX2 antibody recognizes canine, chicken, human, mouse, rat, and pig CDX2.
Rabbit Anti-CDX2 antibody recognizes canine, chicken, human, mouse, rat, and pig CDX2.
Immunogen
Synthetic peptide directed towards the middle region of human CDX2
Application
Rabbit Anti-CDX2 antibody can be used for western blot assays at a concentration of 0.5μg/ml.
Biochem/physiol Actions
CDX2 encodes a protein that plays an important role in gallbladder carcinogenesis with intestinal differentiation. Cdx2 is a highly sensitive marker for Barrett′s esophagus.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: QRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRY
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Yun-Qing Bai et al.
Cancer letters, 176(1), 47-55 (2002-01-16)
The roles of CDX2 and CDX1 homeobox genes during gastric carcinogenesis remain poorly defined. We have studied the expression of CDX2/1 in gastric cancers and intestinal metaplasia (IM) of 69 gastric carcinoma patients by immunohistochemistry. CDX2/1 were shown to be
Dan Strumpf et al.
Development (Cambridge, England), 132(9), 2093-2102 (2005-03-25)
Blastocyst formation marks the segregation of the first two cell lineages in the mammalian preimplantation embryo: the inner cell mass (ICM) that will form the embryo proper and the trophectoderm (TE) that gives rise to the trophoblast lineage. Commitment to
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service