AV32048
Anti-CNOT2 antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-CCR4-NOT transcription complex, subunit 2
Sign In to View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
40 kDa
species reactivity
dog, rabbit, mouse, bovine, human, rat, horse, guinea pig
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CNOT2(4848)
Related Categories
General description
CNOT2 forms a part of the transcriptional regulator, the Ccr4-Not complex, and can repress promoter functions. Studies have reported that depletion of CNOT2 inhibits CCR4-NOT deadenylase and causes apoptosis in cells. Furthermore, the SMRT/NCoR-HDAC3 complex is known to be a cofactor of CNOT2-mediated transcriptional repression.
Rabbit Anti-CNOT2 antibody recognizes bovine, human, mouse, rat, canine, and chicken CNOT2.
Rabbit Anti-CNOT2 antibody recognizes bovine, human, mouse, rat, canine, and chicken CNOT2.
Immunogen
Synthetic peptide directed towards the middle region of human CNOT2
Application
Rabbit Anti-CNOT2 antibody can be used for western blot applications at a concentration of 1.25μg/ml.
Biochem/physiol Actions
CNOT2 is one of the subunits of the CCR4-NOT complex,which functions as general transcription regulation complex.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: SYKDPTSSNDDSKSNLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQ
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Carin G M Zwartjes et al.
The Journal of biological chemistry, 279(12), 10848-10854 (2004-01-07)
The evolutionary conserved Ccr4-Not complex controls mRNA metabolism at multiple levels in eukaryotic cells. Genetic analysis of not mutants in yeast identifies a negative role in transcription, which is dependent on core promoter structure. To obtain direct support for this
Kentaro Ito et al.
Genes to cells : devoted to molecular & cellular mechanisms, 16(4), 368-379 (2011-02-09)
Eukaryotic mRNA decay is initiated by shortening of the poly (A) tail; however, neither the molecular mechanisms underlying deadenylation nor its regulation is well understood. The human CCR4-NOT complex is a major cytoplasmic deadenylase consisting of a combination of at
Sandrine Jayne et al.
The Biochemical journal, 398(3), 461-467 (2006-05-23)
In eukaryotic cells, the Ccr4-Not complex can regulate mRNA metabolism at various levels. Previously, we showed that promoter targeting of the CNOT2 subunit resulted in strong repression of RNA polymerase II transcription, which was sensitive to the HDAC (histone deacetylase)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service