Skip to Content
Merck
CN

AV32064

Sigma-Aldrich

Anti-PAX4 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Paired box gene 4

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

37 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PAX4(5078)

General description

Paired box (PAX) genes are tissue specific homeodomain transcription factors involved in fetal and early animal tissue and cell specification and processes such as limb regeneration. Paired box gene 4 (PAX4) participates in pancreatic islet development and the differentiation of insulin-producing β cells. PAX4) is indispensable for the establishment of the β-cell lineage during development and for mature β-cell expansion and survival.
Rabbit polyclonal anti-PAX4 antibody reacts with canine, rabbit, human, mouse, and rat paired box gene 4 transcription factors.

Immunogen

Synthetic peptide directed towards the middle region of human PAX4

Application

Rabbit Anti-PAX4 antibody can be used for western blot applications at a concentration of 0.5-2.0μg/ml. It can also be used for IHC at 4-8μg/ml using paraffin-embedded tissues.
Rabbit polyclonal anti-PAX4 antibody is used to tag paired box gene 4 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of paired box gene 4 in the differentiation, expansion and survival of pancreatic insulin-producing β cells.

Biochem/physiol Actions

PAX4 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The paired box gene 4 is involved in pancreatic islet development and mouse studies have demonstrated a role for this gene in differentiation of insulin-producing .- cells.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRA

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service