Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
NACRES:
NA.41
UNSPSC Code:
12352203
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
60 kDa
species reactivity
mouse, rat, human, bovine, guinea pig
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CCNL1(57018)
General description
Cyclin L (ania-6a) is an RNA polymerase II-associated cyclin that interacts with key elements of the RNA elongation/processing complex such as the splicing factor SC-35. It is involved in pre-mRNA processing and the regulation of alternative RNA splicing regulation. Cyclin L1 has been linked to the loco-regional progression of human head and neck squamous cell carcinomas (HNSCC) and breast cancer.
The previously assigned protein identifier Q8NI48 has beenmerged into Q9UK58. Full details can be found on the UniProt database.
The previously assigned protein identifier Q8NI48 has beenmerged into Q9UK58. Full details can be found on the UniProt database.
Immunogen
Synthetic peptide directed towards the N terminal region of human CCNL1
Application
Rabbit polyclonal anti-CCNL1 antibody is used to tag cyclin-L1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of cyclin-L1 in RNA elongation and processing, and alternative splicing. Cyclin-L1 is also a potential oncogene with a role in human head and neck squamous cell carcinomas (HNSCC) and breast cancer.
Biochem/physiol Actions
CCNL1 plays a critical role in the loco-regional progression of HNSCC and may serve as an indicator for occult advanced tumour stages. CCNL1 also plays a role in pre-mRNA splicing, has been shown to associate with the PITSLRE kinase, and is involved in pre-mRNA processing.
Rabbit polyclonal anti-CCNL1 antibody reacts with human, mouse, rat, and bovine clyclin-L1 proteins.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: TTTTTTGGILIGDRLYSEVSLTIDHSLIPEERLSPTPSMQDGLDLPSETD
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
Explore all of our products under Anti-CCNL1 antibody produced in rabbit
— or —
Try our Product Selector Tool to narrow your options
Storage Class
10 - Combustible liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Global Trade Item Number
| SKU | GTIN |
|---|---|
| AV33174-100UL | 04061836190170 |