Skip to Content
Merck
CN

AV33174

Sigma-Aldrich

Anti-CCNL1 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Cyclin L1

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

60 kDa

species reactivity

mouse, rat, human, bovine, guinea pig

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CCNL1(57018)

General description

Cyclin L (ania-6a) is an RNA polymerase II-associated cyclin that interacts with key elements of the RNA elongation/processing complex such as the splicing factor SC-35. It is involved in pre-mRNA processing and the regulation of alternative RNA splicing regulation. Cyclin L1 has been linked to the loco-regional progression of human head and neck squamous cell carcinomas (HNSCC) and breast cancer.

The previously assigned protein identifier Q8NI48 has beenmerged into Q9UK58. Full details can be found on the UniProt database.

Immunogen

Synthetic peptide directed towards the N terminal region of human CCNL1

Application

Rabbit polyclonal anti-CCNL1 antibody is used to tag cyclin-L1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of cyclin-L1 in RNA elongation and processing, and alternative splicing. Cyclin-L1 is also a potential oncogene with a role in human head and neck squamous cell carcinomas (HNSCC) and breast cancer.

Biochem/physiol Actions

CCNL1 plays a critical role in the loco-regional progression of HNSCC and may serve as an indicator for occult advanced tumour stages. CCNL1 also plays a role in pre-mRNA splicing, has been shown to associate with the PITSLRE kinase, and is involved in pre-mRNA processing.
Rabbit polyclonal anti-CCNL1 antibody reacts with human, mouse, rat, and bovine clyclin-L1 proteins.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: TTTTTTGGILIGDRLYSEVSLTIDHSLIPEERLSPTPSMQDGLDLPSETD

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service