Skip to Content
Merck
CN
All Photos(1)

Key Documents

AV34313

Sigma-Aldrich

Anti-RBPJL antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-RBP-L, Anti-RBPSUHL, Anti-Recombination signal binding protein for immunoglobulin kappa J region-like, Anti-SUH, Anti-SUHL

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

57 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... RBPJL(11317)

General description

RBPJL (SUHL or RBPSUHL) is the human homolog of Drosophila Suppressor of Hairless. Mouse Rbpj functions as a transcription factor and modulates the Notch signaling pathway to maintain neural progenitors. It complexes with Ptf1a to regulate the specification of GABAergic neurons in mouse neural tubes.
Rabbit Anti-RBPJL antibody recognizes bovine, human, mouse, and rat RBPJL.

Immunogen

Synthetic peptide directed towards the N terminal region of human RBPJL

Application

Rabbit Anti-RBPJL can be used for western blot applications at a concentration of 2.5 μg/ml.

Biochem/physiol Actions

In mouse, recombining binding protein L (RBP-L) is a transcription factor that binds to DNA sequences almost identical to that bound by the Notch receptor signalling pathway transcription factor RBP-J. However, unlike RBP-J, RBP-L does not interact with Notch receptors. RBP-L has been shown to activate transcription in concert with Epstein-Barr virus nuclear antigen-2 (EBNA2). RBPSUHL is similar in sequence to the mouse RPB-L protein and Drosophila suppressor of hairless protein.In mouse, recombining binding protein L (RBP-L) is a transcription factor that binds to DNA sequences almost identical to that bound by the Notch receptor signalling pathway transcription factor RBP-J. However, unlike RBP-J, RBP-L does not interact with Notch receptors. RBP-L has been shown to activate transcription in concert with Epstein-Barr virus nuclear antigen-2 (EBNA2). The protein encoded by this gene is similar in sequence to the mouse RPB-L protein and Drosophila suppressor of hairless protein.

Sequence

Synthetic peptide located within the following region: AHQAGETGPTVCGYMGLDSASGSATETQKLNFEQQPDSREFGCAKTLYIS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service