AV34429
Anti-USF1 (AB2) antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-Upstream transcription factor 1
Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
NACRES:
NA.41
UNSPSC Code:
12352203
Product Name
Anti-USF1 (AB2) antibody produced in rabbit, IgG fraction of antiserum
biological source
rabbit
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
34 kDa
species reactivity
bovine, rat, human, dog, rabbit, horse, mouse, guinea pig
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Quality Level
Gene Information
human ... USF1(7391)
Related Categories
Application
Rabbit Anti-USF1 (AB2) can be used for western blot applications at 1.25 μg/ml.
Biochem/physiol Actions
USF1 encodes a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. This gene has been linked to familial combined hyperlipidemia (FCHL).
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
USF1 is a leucine zipper transcription factor that forms a part of complexes that interact with fatty acid synthase (FAS) insulin response sequence (IRS). Valproic acid (VPA) is known to inhibit adipogenesis by repressing USF1-induced synthesis of fatty acids. Studies have reported that USF1 gene is associated with familial combined hyperlipidemia (FCHL).
Rabbit Anti-USF1 (AB2) antibody recognizes human, mouse, rat, rabbit, canine, chicken, pig, and bovine USF1.
Rabbit Anti-USF1 (AB2) antibody recognizes human, mouse, rat, rabbit, canine, chicken, pig, and bovine USF1.
Immunogen
Synthetic peptide directed towards the N terminal region of human USF1
Other Notes
Synthetic peptide located within the following region: DPTSVAIASIQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQLDGQTE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
D Wang et al.
The Journal of biological chemistry, 270(48), 28716-28722 (1995-12-01)
Fatty acid synthase (FAS) plays a central role in de novo lipogenesis in mammals. The concentration or activity of FAS in liver and adipose tissue changes dramatically when animals are subjected to nutritional and hormonal manipulations. We previously reported that
Päivi Pajukanta et al.
Nature genetics, 36(4), 371-376 (2004-03-03)
Familial combined hyperlipidemia (FCHL), characterized by elevated levels of serum total cholesterol, triglycerides or both, is observed in about 20% of individuals with premature coronary heart disease. We previously identified a locus linked to FCHL on 1q21-q23 in Finnish families
Miki Yuyama et al.
The Biochemical journal, 459(3), 489-503 (2014-02-12)
VPA (valproic acid), a short-chain fatty acid that is a HDAC (histone deacetylase) inhibitor, is known to suppress adipogenesis. In the present study, we identified the molecular mechanism of VPA-mediated suppression of adipogenesis in adipocytes. VPA suppressed the accumulation of
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service