Skip to Content
Merck
CN

AV34593

Sigma-Aldrich

Anti-ZA20D1 antibody produced in rabbit

IgG fraction of antiserum

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

94 kDa

species reactivity

dog, human, bovine, pig, mouse, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... ZA20D1(56957)

General description

OTU deubiquitinase 7B (OTUD7B or CEZANNE or ZA20D1) is a de-ubiquitinating enzyme that is known to affect actin structure. It has been implicated in the invasion of squamous cell carcinoma (SCC).
Rabbit Anti-ZA20D1 antibody recognizes human, mouse, rat, canine, and bovine ZA20D1.

Immunogen

Synthetic peptide directed towards the middle region of human ZA20D1

Application

Rabbit Anti-ZA20D1 antibody can be used for western blot applications at a concentration of 1.25 μg/ml.

Biochem/physiol Actions

The ZA20D1 gene encodes an enzyme that cleaves ubiquitin from proteins. This gene has the ability to down-regulate NF-kappa B which plays a pivotal role in inflammatory processes through induction of adhesion molecules and chemokines.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: WKGGKEEAAGDGPVSEKPPAESVGNGGSKYSQEVMQSLSILRTAMQGEGK

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

S I Chaudhry et al.
Oncogene, 32(6), 747-758 (2012-03-28)
The invasion of squamous cell carcinoma (SCC) is a significant cause of morbidity and mortality. Here, we identify an E3 ligase, Traf6 and a de-ubiquitinating enzyme, Cezanne/ZA20D1, as important regulators of this process in organotypic models. Traf6 can promote the

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service