Skip to Content
Merck
CN

AV39074

Anti-CBX6 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Chromobox homolog 6

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

44 kDa

species reactivity

mouse, human, guinea pig, horse, bovine, dog, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CBX6(23466)

Immunogen

Synthetic peptide directed towards the C terminal region of human CBX6

Biochem/physiol Actions

CBX6 (chromobox homolog 6) is a transcription repressor belonging to the polycomb CBX family. CBX family members are associated with chromatin in different subnuclear regions and control the development in embryonic stem cells and fibroblasts.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: SAATSKRAPPEVTAAAGPAPPTAPEPAGASSEPEAGDWRPEMSPCSNVVV

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Claudius Vincenz et al.
Proceedings of the National Academy of Sciences of the United States of America, 105(43), 16572-16577 (2008-10-18)
Polycomb group proteins are transcriptional repressors recruited to many developmental control genes. The specificity of polycomb group protein targeting is incompletely understood. Subunits of polycomb repressive complexes (PRC) are encoded by multigene families in vertebrates. Five chromodomain-containing CBX family proteins
Fushun Li et al.
Gastroenterology research and practice, 2021, 6832518-6832518 (2021-08-13)
Hepatocellular carcinoma (HCC) accounts for approximately ninety percent of primary liver cancer. This study attempted to investigate the effects of the long noncoding RNA MIR100HG (MIR100HG) in HCC and the underlying molecular mechanism. qRT-PCR was implemented to analyze the expression

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service