Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
NACRES:
NA.41
UNSPSC Code:
12352203
Product Name
Anti-NKRF antibody produced in rabbit, IgG fraction of antiserum
Gene Information
human ... NKRF(55922)
biological source
rabbit
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
44 kDa
species reactivity
human, pig, horse, dog
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Quality Level
Related Categories
Application
Rabbit Anti-NKRF antibody is suitable for western blot applications at a concentration of 2.5 μg/ml.
Biochem/physiol Actions
NKRF is a transcription factor that interacts with specific negative regulatory elements (NREs) to mediate transcriptional repression of certain NK-kappa-B-responsive genes. NKRF localizes predominantly to the nucleolus with a small fraction found in the nucleoplasm and cytoplasm.This gene encodes a transcription factor that interacts with specific negative regulatory elements (NREs) to mediate transcriptional repression of certain NK-kappa-B-responsive genes. The protein localizes predominantly to the nucleolus with a small fraction found in the nucleoplasm and cytoplasm.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
NKRF codes for a nuclear protein that functions as a repressing factor for NF-κB. NKRF suppresses the stimulation of hiNOS, IL-8, IFN, and HIV-1 by NFκB.
Rabbit Anti-NKRF antibody recognizes bovine, human, mouse, rat, and canine NKRF.
Rabbit Anti-NKRF antibody recognizes bovine, human, mouse, rat, and canine NKRF.
Immunogen
Synthetic peptide directed towards the N terminal region of human NKRF
Other Notes
Synthetic peptide located within the following region: MEKILQMAEGIDIGEMPSYDLVLSKPSKGQKRHLSTCDGQNPPKKQAGSK
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Gene expression profile of NFκB repressing factor (NKRF) knockdown cells by microarray analysis
Sun, Y., et al.
BioChip Journal, 6(3), 247-253 (2012)
Yung-Yang Liu et al.
PloS one, 8(6), e66760-e66760 (2013-07-11)
High-tidal-volume mechanical ventilation used in patients with acute lung injury (ALI) can induce the release of inflammatory cytokines, as macrophage inflammatory protein-2 (MIP-2), recruitment of neutrophils, and disruption of alveolar epithelial and endothelial barriers. Induced pluripotent stem cells (iPSCs) have
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service