Skip to Content
Merck
CN

AV39348

Anti-ZNF444 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Zinc finger protein 444

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

NACRES:
NA.41
UNSPSC Code:
12352203
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

Product Name

Anti-ZNF444 antibody produced in rabbit, IgG fraction of antiserum

biological source

rabbit

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

35 kDa

species reactivity

mouse, rabbit, human, rat, dog, bovine

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Quality Level

Gene Information

human ... ZNF444(55311)

Related Categories

Application

Rabbit Anti-ZNF444 antibody is suitable for western blot applications at a concentration of 2.5 μg/ml.

Biochem/physiol Actions

ZNF444 has a domain structure and amino acid sequence similar to several zinc finger transcription factors, which strongly suggested that ZNF444 is a transcriptional regulator.ZNF444 has a domain structure and amino acid sequence similar to several zinc finger transcription factors, such as Kruppel-like ZNF191 (MIM 194534).[supplied by OMIM].

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

ZNF444 codes for a zinc finger protein that stimulates the transcription of a scavenger receptor gene. This subsequently plays a role in the breakdown of acetylated low density lipoprotein (Ac-LDL). The EWSR1-ZNF444 fusion gene has been implicated in myoepithelial carcinomas of soft tissues.
Rabbit Anti-ZNF444 antibody recognizes human, mouse, rat, canine, and bovine ZNF444.

Immunogen

Synthetic peptide directed towards the C terminal region of human ZNF444

Other Notes

Synthetic peptide located within the following region: ACCECGKTFYWREHLVRHRKTHSGARPFACWECGKGFGRREHVLRHQRIH

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Petter Brandal et al.
Genes, chromosomes & cancer, 48(12), 1051-1056 (2009-09-18)
Myoepithelial neoplasms of soft tissue have only recently been acknowledged as a separate diagnostic entity. To know based on histological appearance whether these tumors are benign or malignant is often difficult, and their tumorigenic mechanisms remain poorly understood. We report

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service