AV39348
Anti-ZNF444 antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-Zinc finger protein 444
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
35 kDa
species reactivity
mouse, rabbit, human, rat, dog, bovine
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... ZNF444(55311)
Related Categories
General description
ZNF444 codes for a zinc finger protein that stimulates the transcription of a scavenger receptor gene. This subsequently plays a role in the breakdown of acetylated low density lipoprotein (Ac-LDL). The EWSR1-ZNF444 fusion gene has been implicated in myoepithelial carcinomas of soft tissues.
Rabbit Anti-ZNF444 antibody recognizes human, mouse, rat, canine, and bovine ZNF444.
Rabbit Anti-ZNF444 antibody recognizes human, mouse, rat, canine, and bovine ZNF444.
Immunogen
Synthetic peptide directed towards the C terminal region of human ZNF444
Application
Rabbit Anti-ZNF444 antibody is suitable for western blot applications at a concentration of 2.5 μg/ml.
Biochem/physiol Actions
ZNF444 has a domain structure and amino acid sequence similar to several zinc finger transcription factors, which strongly suggested that ZNF444 is a transcriptional regulator.ZNF444 has a domain structure and amino acid sequence similar to several zinc finger transcription factors, such as Kruppel-like ZNF191 (MIM 194534).[supplied by OMIM].
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: ACCECGKTFYWREHLVRHRKTHSGARPFACWECGKGFGRREHVLRHQRIH
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Petter Brandal et al.
Genes, chromosomes & cancer, 48(12), 1051-1056 (2009-09-18)
Myoepithelial neoplasms of soft tissue have only recently been acknowledged as a separate diagnostic entity. To know based on histological appearance whether these tumors are benign or malignant is often difficult, and their tumorigenic mechanisms remain poorly understood. We report
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service