Anti-ZNF444 antibody produced in rabbit

ZNF444 codes for a zinc finger protein that stimulates the transcription of a scavenger receptor gene. This subsequently plays a role in the breakdown of acetylated low density lipoprotein (Ac-LDL). The EWSR1-ZNF444 fusion gene has been implicated in myoepithelial carcinomas of soft tissues.
Rabbit Anti-ZNF444 antibody recognizes human, mouse, rat, canine, and bovine ZNF444.

Synthetic peptide directed towards the C terminal region of human ZNF444

Rabbit Anti-ZNF444 antibody is suitable for western blot applications at a concentration of 2.5 μg/ml.

ZNF444 has a domain structure and amino acid sequence similar to several zinc finger transcription factors, which strongly suggested that ZNF444 is a transcriptional regulator.ZNF444 has a domain structure and amino acid sequence similar to several zinc finger transcription factors, such as Kruppel-like ZNF191 (MIM 194534).[supplied by OMIM].

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Synthetic peptide located within the following region: ACCECGKTFYWREHLVRHRKTHSGARPFACWECGKGFGRREHVLRHQRIH

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.