Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
NACRES:
NA.41
UNSPSC Code:
12352203
Conjugate:
unconjugated
Clone:
polyclonal
Application:
western blot
Species reactivity:
rat, bovine, horse, guinea pig, human, rabbit, dog
Citations:
3
Technique(s):
western blot: suitable
Uniprot accession no.:
Product Name
Anti-DCP1A (AB2) antibody produced in rabbit, IgG fraction of antiserum
biological source
rabbit
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
56 kDa
species reactivity
rat, bovine, horse, guinea pig, human, rabbit, dog
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... DCP1A(55802)
Related Categories
Application
Rabbit Anti-DCP1A antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.
Biochem/physiol Actions
Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway.Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
DCP1A is an mRNA decapping enzyme that is involved in TGF-β signaling. DCP1A is known to be hyper-phosphorylated during mitosis, cellular stress, neuronal differentiation and brain development. DCP1A has also been implicated in translational arrest.
Rabbit Anti-DCP1A antibody recognizes rat, human, chicken, bovine, canine, zebrafish, and mouse DCP1A.
Rabbit Anti-DCP1A antibody recognizes rat, human, chicken, bovine, canine, zebrafish, and mouse DCP1A.
Immunogen
Synthetic peptide directed towards the N terminal region of human DCP1A
Other Notes
Synthetic peptide located within the following region: MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDI
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Jonathan D Dougherty et al.
The Journal of biological chemistry, 289(7), 3936-3949 (2014-01-03)
We have shown previously that poliovirus infection disrupts cytoplasmic P-bodies in infected mammalian cells. During the infectious cycle, poliovirus causes the directed cleavage of Dcp1a and Pan3, coincident with the dispersion of P-bodies. We now show that expression of Dcp1a
Jacob Blumenthal et al.
FEBS letters, 583(1), 197-201 (2008-12-17)
Decapping protein 1a (Dcp1a) is found in P-bodies and functions in mRNA cap removal prior to its degradation. The function and binding partners of Dcp1a have been thoroughly studied, however its expression pattern is still unclear. In this study we
Adva Aizer et al.
PloS one, 8(1), e49783-e49783 (2013-01-10)
Processing bodies (PBs) are non-membranous cytoplasmic structures found in all eukaryotes. Many of their components such as the Dcp1 and Dcp2 proteins are highly conserved. Using live-cell imaging we found that PB structures disassembled as cells prepared for cell division
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service