Skip to Content
Merck
CN

AV40681

Sigma-Aldrich

Anti-SURF6 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Surfeit 6

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

40 kDa

species reactivity

human, horse

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... SURF6(6838)

General description

The gene SURF6 (surfeit 6) encodes a member of the Surfeit locus that is found to be localized to the nucleolus. The encoded protein is a unique component of the nucleolar matrix system with no sequence similarity with any other known protein.

Immunogen

Synthetic peptide directed towards the middle region of human SURF6

Biochem/physiol Actions

The gene SURF6 (surfeit 6) encodes a protein that has the ability to bind to nucleic-acids, with more affinity for RNA. It is found to be a structural protein that is present at all stages of the cell cycle in nucleolar substructures. It may be involved in the structure and functions of the nucleolar matrix by associating with nucleic acids. It may also be involved in rRNA (ribosomal RNA) processing.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: EPREPPGLIFNKVEVSEDEPASKAQRRKEKRQRVKGNLTPLTGRNYRQLL

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

新产品

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

The SURF-6 protein is a component of the nucleolar matrix and has a high binding capacity for nucleic acids in vitro
Magoulas C
European Journal of Cell Biology, 75, 174-183 (1998)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service