Skip to Content
Merck
CN

AV41168

Sigma-Aldrich

Anti-EIF4E3 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Eukaryotic translation initiation factor 4E family member 3, Anti-MGC39820, Anti-MGC86971

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

24 kDa

species reactivity

bovine, mouse, rabbit, rat, horse, dog, guinea pig, human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified, unmodified

Gene Information

human ... EIF4E3(317649)

Related Categories

General description

Eukaryotic translation initiation factor 4E family member 3 (EIF4E3) is a member of the eukaryotic translation initiation factor 4E (eIF4E) family involved in the initiation of mRNA translation by binding to its 5′-prime cap structure and targeting the mRNA to the ribosome.

Immunogen

Synthetic peptide directed towards the middle region of human EIF4E3

Application

Anti-EIF4E3 polyclonal antibody is used to tag eukaryotic translation initiation factor 4E family member 3 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of eukaryotic translation initiation factor 4E family member 3 in the initiation of mRNA translation.

Biochem/physiol Actions

Anti-EIF4E3 polyclonal antibody reacts with chicken, human, mouse, rat, bovine, and zebrafish eukaryotic translation initiation factor 4E family member 3 proteins.
EIF4E3 belongs to the EIF4E family of translational initiation factors that interact with the 5-prime cap structure of mRNA and recruit mRNA to the ribosome.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: VQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHHAFEGGRGKH

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service