biological source
rabbit
Quality Segment
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
33 kDa
species reactivity
bovine, mouse, dog, human, rabbit, horse, rat
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable, western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... TST(7263)
General description
Thiosulfate sulfurtransferase (rhodanese) (TST, RDS) is a mitochondrial matrix enzyme that facilitates the modification of sulfur-containing enzymes, and detoxification of H2S and cyanide. Thiosulfate sulfurtransferase converts cyanide into thiocyanide.
Immunogen
Synthetic peptide directed towards the middle region of human TST
Application
Anti-TST polyclonal antibody is used to tag thiosulfate sulfurtransferase/rhodanese for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of thiosulfate sulfurtransferase/rhodanese in hydrogen sulfide and cyanide detoxification.
Biochem/physiol Actions
Anti-TST polyclonal antibody reacts with human, mouse, rat, bovine, canine, and chicken thiosulfate sulfurtransferase/rhodanese enzymes.
TST is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.The product of this gene is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The gene product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
存储类别
10 - Combustible liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable