Skip to Content
Merck
CN

AV43518

Anti-GOT2 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Got2 Antibody, Got2 Antibody - Anti-GOT2 (AB2) antibody produced in rabbit, Anti-FLJ40994, Anti-Glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2), Anti-Kat4, Anti-Kativ, Anti-Mitaat

Sign In to View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

45 kDa

species reactivity

rat, rabbit, dog, mouse, horse, human, guinea pig, bovine

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GOT2(2806)

General description

Glutamic-oxaloacetic transaminase 2 (GOT2) in an inner-membrane mitochondrial enzyme that interconverts the amino acids aspartate and glutamate and the TCA cycle components α-ketoglutarate and oxaloacetate. The enzyme facilitates a balance between energy metabolism and amino acid composition.

Immunogen

Synthetic peptide directed towards the C terminal region of human GOT2

Application

Anti-GOT2 (AB2) polyclonal antibody is used to tag mitochondrial aspartate aminotransferase protein for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of mitochondrial aspartate aminotransferase in energy metabolism and amino acid composition management by cells.

Biochem/physiol Actions

Anti-GOT2 (AB2) polyclonal antibody reacts with bovine, pig, chicken, human, mouse, rat, and zebrafish mitochondrial aspartate aminotransferases.
Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: AILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQI

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service