Skip to Content
Merck
CN

AV44268

Sigma-Aldrich

Anti-TGFBI antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-BIGH3, Anti-CDB1, Anti-CDG2, Anti-CDGG1, Anti-CSD, Anti-CSD1, Anti-CSD2, Anti-Transforming growth factor, β-induced, 68 kDa

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

46 kDa

species reactivity

horse, human, guinea pig, mouse, bovine, rabbit

concentration

0.5 mg - 1 mg/mL

technique(s)

immunofluorescence: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TGFBI(7045)

General description

Transforming growth factor, β-induced, 68 kDa (TGFB1, BIGH3, CDB1, CDG2, CDGG1, CSD) is a cell signaling protein with a wide range of functions, mostly as a negative/suppressive modulator of cell growth. TGFB1 is a modulator of immune function and an inducer of cell transformation. The actions of TGFB1 are mediated via transforming growth factor β receptors.

Immunogen

Synthetic peptide directed towards the C terminal region of human TGFBI

Application

Anti-TGFBI polyclonal antibody is used to tag transforming growth factor, β 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of transforming growth factor, β 1 in cell signaling within a wide range of cell types.

Biochem/physiol Actions

Anti-TGFBI polyclonal antibody reacts with chicken, human, mouse, rat, bovine, pig, and rabbit transforming growth factor, β 1 proteins.
TGFBI Binds to type I, II, and IV collagens. This adhesion protein may play an important role in cell-collagen interactions. In cartilage, may be involved in endochondral bone formation.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Yu-Ping Han et al.
Current eye research, 37(11), 990-996 (2012-07-04)
Types 1 and 2 granular corneal dystrophies (GCD) are primarily associated with accumulation of the R555W and R124H mutant transforming growth factor β-inducible proteins (TGFBIp) in corneal stroma, respectively. However, specific components of TGFBIp responsible for granular deposits have not
Sergio Sastriques-Dunlop et al.
Scientific reports, 14(1), 1438-1438 (2024-01-17)
Abdominal aortic aneurysms (AAAs) are prevalent with aging, and AAA rupture is associated with increased mortality. There is currently no effective medical therapy to prevent AAA rupture. The monocyte chemoattractant protein (MCP-1)/C-C chemokine receptor type 2 (CCR2) axis critically regulates

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service