Skip to Content
Merck
CN

AV44806

Sigma-Aldrich

Anti-USP48 (AB1) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-DKFZp762M1713, Anti-MGC132556, Anti-MGC14879, Anti-RAP1GA1, Anti-USP31, Anti-Ubiquitin specific peptidase 48

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

70 kDa

species reactivity

rat, guinea pig, rabbit, dog, mouse, horse, human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... USP48(84196)

Related Categories

Immunogen

Synthetic peptide directed towards the C terminal region of human USP48

Application

Anti-USP48 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

Ubiquitin specific peptidase 48 (USP48; USP31) is a deubiquitinating enzyme that belongs to C19 peptidase family. It recognizes and hydrolyzes the peptide bond of ubiquitin at the C-terminal glycine. USP48 reportedly interacts with p65/RelA subunits of NF-κB and regulates its activation.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: PQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCS

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

K D Wilkinson
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 11(14), 1245-1256 (1997-12-31)
An astounding number of important regulatory and structural proteins are subject to modification by the attachment of ubiquitin or ubiquitin-like proteins. This modification acts as a targeting signal, delivering the modified protein to different locations in the cell and modifying
Christos Tzimas et al.
Cellular signalling, 18(1), 83-92 (2005-10-11)
TRAF2 mediates activation of the transcription factors NF-kappaB and AP1 by TNF. A yeast two-hybrid screen of a human cDNA library identified a ubiquitin specific protease homologue (USP31) as a TRAF2-interacting protein. Two cDNAs encoding for USP31 were identified. One

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service