Skip to Content
Merck
CN

AV45004

Sigma-Aldrich

Anti-CRELD1 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-AVSD2, Anti-CIRRIN, Anti-Cysteine-rich with EGF-like domains 1, Anti-DKFZP566D213

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

45 kDa

species reactivity

dog, guinea pig, bovine, horse, human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CRELD1(78987)

General description

Cysteine-rich with EGF-like domains 1 (CRELD1), a highly conserved membrane bound extracellular protein that defines a new epidermal growth factor-related gene family, is a cell adhesion molecule associated with cardiac atrioventricular septal defects (AVSD) and congenital heart disease (CHD).

Immunogen

Synthetic peptide directed towards the C terminal region of human CRELD1

Application

Anti-CRELD1 polyclonal antibody is used to tag cysteine-rich with EGF-like domains 1 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of cysteine-rich with EGF-like domains 1 in cardiac diseases such as AVSD and CDH.

Biochem/physiol Actions

Anti-CRELD1 polyclonal antibody detects canine, human, bovine, mouse, and and rat cysteine-rich with EGF-like domains 1 proteins.
Epidermal growth factor (EGF; MIM 131530)-like repeats are a class of cysteine-rich domains that mediate interactions between proteins of diverse function. EGF domains are found in proteins that are either completely secreted or have transmembrane regions that tether the protein to the cell surface. CRELD1 is the founding member of a family of matricellular proteins.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: TEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPESAGFFSEMTE

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service