AV46356
Anti-LMNB2 antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-LAMB2, Anti-LMN2, Anti-Lamin B2, Anti-MGC2721
Sign In to View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
68 kDa
species reactivity
bovine, horse, guinea pig, mouse, human
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... LMNB2(84823)
Immunogen
Synthetic peptide directed towards the N terminal region of human LMNB2
Application
Anti-LMNB2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml.
Biochem/physiol Actions
LMNB2 (lamin B2) gene also referred to as LAMB2, LMN2, or MGC2721 encodes for a B type nuclear lamin. Lamins consist of two types, A and B, and are involved in nuclear stability chromatin structure and gene expression. Lamin B which is a structural component of the interphase nuclear lamina facilitates the stimulation of microtubule assembly and organization in mitosis. Mutation in LMNB2 gene leads to acquired partial lipodystrophy.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: MATPLPGRAGGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELE
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Thomas Dechat et al.
Genes & development, 22(7), 832-853 (2008-04-03)
Over the past few years it has become evident that the intermediate filament proteins, the types A and B nuclear lamins, not only provide a structural framework for the nucleus, but are also essential for many aspects of normal nuclear
Jinzhi Gao et al.
Journal of pediatric endocrinology & metabolism : JPEM, 25(3-4), 375-377 (2012-07-10)
Acquired partial lipodystrophy (APL) is a rare disorder, mainly characterized by progressive loss of subcutaneous fatty tissue, starting from the face and spreading to the upper part of the body. The etiology of APL is unknown. It may be caused
Ming-Ying Tsai et al.
Science (New York, N.Y.), 311(5769), 1887-1893 (2006-03-18)
Mitotic spindle morphogenesis is a series of highly coordinated movements that lead to chromosome segregation and cytokinesis. We report that the intermediate filament protein lamin B, a component of the interphase nuclear lamina, functions in spindle assembly. Lamin B assembled
Roopali Pradhan et al.
Nucleic acids research, 46(11), 5561-5586 (2018-04-24)
Cells perceive and relay external mechanical forces into the nucleus through the nuclear envelope. Here we examined the effect of lowering substrate stiffness as a paradigm to address the impact of altered mechanical forces on nuclear structure-function relationships. RNA sequencing
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service